PDB entry 5vzy

View 5vzy on RCSB PDB site
Description: Crystal structure of crenezumab Fab in complex with Abeta
Class: immune system
Keywords: Immunoglobulin, IMMUNE SYSTEM
Deposited on 2017-05-29, released 2017-08-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.32 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amyloid beta a4 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: APP, A4, AD1
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Crenezumab Fab heavy chain,Immunoglobulin gamma-1 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5VZY (0-106)
    • Uniprot P0DOX5 (107-End)
  • Chain 'L':
    Compound: Crenezumab Fab light chain,Immunoblobulin light chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5VZY (0-108)
    • Uniprot Q0KKI6 (109-End)
    Domains in SCOPe 2.07: d5vzyl1, d5vzyl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5vzyL (L:)
    divmtqsplslpvtpgepasiscrssqslvysngdtylhwylqkpgqspqlliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedvgvyycsqsthvpwtfgqgtkveikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vzyL (L:)
    divmtqsplslpvtpgepasiscrssqslvysngdtylhwylqkpgqspqlliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedvgvyycsqsthvpwtfgqgtkveikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrge