PDB entry 5vzt

View 5vzt on RCSB PDB site
Description: Crystal structure of the Skp1-FBXO31 complex
Class: cell cycle
Keywords: ubiquitin ligase, CELL CYCLE
Deposited on 2017-05-29, released 2018-01-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-01-17, with a file datestamp of 2018-01-12.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: S-phase kinase-associated protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SKP1, EMC19, OCP2, SKP1A, TCEB1L
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63208 (Start-148)
      • engineered mutation (1)
      • see remark 999 (66)
    Domains in SCOPe 2.07: d5vzta1, d5vzta2
  • Chain 'B':
    Compound: F-box only protein 31
    Species: Homo sapiens [TaxId:9606]
    Gene: FBXO31, FBX14, FBX31, PP2386
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5XUX0 (14-487)
      • expression tag (11-13)
  • Chain 'C':
    Compound: S-phase kinase-associated protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SKP1, EMC19, OCP2, SKP1A, TCEB1L
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63208 (Start-148)
      • engineered mutation (1)
    Domains in SCOPe 2.07: d5vztc1, d5vztc2
  • Chain 'D':
    Compound: F-box only protein 31
    Species: Homo sapiens [TaxId:9606]
    Gene: FBXO31, FBX14, FBX31, PP2386
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5XUX0 (14-487)
      • expression tag (12-13)
  • Heterogens: ZN, DTT, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vztA (A:)
    masiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhk
    ddpggsgtddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpee
    irktfnikndfteeeeaqvrkenqwceek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vztA (A:)
    asiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhkd
    dpgtddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirkt
    fnikndfteeeeaqvrkenqwceek
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5vztC (C:)
    masiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhk
    ddpggsgtddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpee
    irktfnikndfteeeeaqvrkenqwceek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vztC (C:)
    asiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhkd
    dpddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfn
    ikndfteeeeaqvrkenqwceek
    

  • Chain 'D':
    No sequence available.