PDB entry 5vzr

View 5vzr on RCSB PDB site
Description: Crystal Structure of MERS-CoV neutralizing antibody G4 Fab
Class: immune system
Keywords: immune system, antibody, neutralizing
Deposited on 2017-05-29, released 2017-08-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: G4 antibody heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5VZR (0-End)
  • Chain 'B':
    Compound: G4 antibody light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5VZR (0-End)
    Domains in SCOPe 2.07: d5vzrb1, d5vzrb2
  • Chain 'H':
    Compound: G4 antibody heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5VZR (0-End)
  • Chain 'L':
    Compound: G4 antibody light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5VZR (0-End)
    Domains in SCOPe 2.07: d5vzrl1, d5vzrl2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5vzrB (B:)
    divltqspaslavslgqratiscrasesvdnygisfmnwfqqkpgqppkllisatsnqgs
    gvparfigsgsgtdfslnihpveeddtamyfcqqskevprtfgggtkleikrtdaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vzrB (B:)
    divltqspaslavslgqratiscrasesvdnygisfmnwfqqkpgqppkllisaarfigs
    gsgtdfslnihpveeddtamyfcqqskevprtfgggtkleikrtdaaptvsifppsseql
    tsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltltkde
    yerhnsytceathktstspivksfnrne
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5vzrL (L:)
    divltqspaslavslgqratiscrasesvdnygisfmnwfqqkpgqppkllisatsnqgs
    gvparfigsgsgtdfslnihpveeddtamyfcqqskevprtfgggtkleikrtdaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vzrL (L:)
    divltqspaslavslgqratiscrasesvdnygisfmnwfqqkpgqppkllisatarfig
    sgsgtdfslnihpveeddtamyfcqqskevprtfgggtkleikrtdaaptvsifppsseq
    ltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltltkd
    eyerhnsytceathktstspivksfnrne