PDB entry 5vyv

View 5vyv on RCSB PDB site
Description: Crystal structure of a protein of unknown function YceH/ECK1052 involved in membrane biogenesis from Escherichia coli
Class: unknown function
Keywords: unknown function, membrane biogenesis, alpha/beta protein, structural genomics, center for structural genomics of infectious diseases, csgid, national institute of allergy and infectious diseases, niaid
Deposited on 2017-05-26, released 2017-06-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 2.48 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UPF0502 protein YceH
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: yceH, Z1704, ECs1445
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vyva1, d5vyva2
  • Chain 'B':
    Compound: UPF0502 protein YceH
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: yceH, Z1704, ECs1445
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vyvb1, d5vyvb2
  • Heterogens: PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vyvA (A:)
    mkyqltalearvigcllekqvttpeqyplsvngvvtacnqktnrepvmnlsesevqeqld
    nlvkrhylrtvsgfgnrvtkyeqrfcnsefgdlklsaaevalittlllrgaqtpgelrsr
    aarmyefsdmaeveltleqlanredgpfvvrlarepgkresrymhlfsgevedqpavtdm
    snavdgdlqarvealeievaelkqrldsllahlgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vyvA (A:)
    mkyqltalearvigcllekqvttpeqyplsvngvvtacnqktnrepvmnlsesevqeqld
    nlvkrhylrtvsgfgnrvtkyeqrfcnsefgdlklsaaevalittlllrgaqtpgelrsr
    aarmyefsdmaeveltleqlanredgpfvvrlarepgkresrymhlfsgeved
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5vyvB (B:)
    mkyqltalearvigcllekqvttpeqyplsvngvvtacnqktnrepvmnlsesevqeqld
    nlvkrhylrtvsgfgnrvtkyeqrfcnsefgdlklsaaevalittlllrgaqtpgelrsr
    aarmyefsdmaeveltleqlanredgpfvvrlarepgkresrymhlfsgevedqpavtdm
    snavdgdlqarvealeievaelkqrldsllahlgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vyvB (B:)
    mkyqltalearvigcllekqvttpeqyplsvngvvtacnqktnrepvmnlsesevqeqld
    nlvkrhylrtvsgrvtkyeqrfcnsefgdlklsaaevalittlllrgaqtpgelrsraar
    myefsdmaeveltleqlanredgpfvvrlarepgkresrymhlfsgeved