PDB entry 5vyb

View 5vyb on RCSB PDB site
Description: Structure of the carbohydrate recognition domain of Dectin-2 complexed with a mammalian-type high mannose Man9GlcNAc2 oligosaccharide
Class: sugar binding protein
Keywords: carbohydrate-binding protein; lectin; glycoprotein, SUGAR BINDING PROTEIN
Deposited on 2017-05-24, released 2017-07-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C-type lectin domain family 6 member A
    Species: Homo sapiens [TaxId:9606]
    Gene: CLEC6A, CLECSF10, DECTIN2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6EIG7 (1-146)
      • expression tag (0)
    Domains in SCOPe 2.07: d5vyba1, d5vyba2
  • Heterogens: MAN, BMA, CA, NA, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vybA (A:)
    altcfsegtkvpawgccpaswksfgsscyfisseekvwskseqncvemgahlvvfnteae
    qnfivqqlnesfsyflglsdpqgnnnwqwidktpyeknvrfwhlgepnhsaeqcasivfw
    kptgwgwndvicetrrnsicemnkiyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vybA (A:)
    altcfsegawgccpaswksfgsscyfisseekvwskseqncvemgahlvvfnteaeqnfi
    vqqlnesfsyflglsdpqgnnnwqwidktpyeknvrfwhlgepnhsaeqcasivfwkptg
    wgwndvicetrrnsicemnkiyl