PDB entry 5vvw

View 5vvw on RCSB PDB site
Description: Structure of MurC from Pseudomonas aeruginosa
Class: ligase
Keywords: MurC, Pseudomonas aeruginosa, SSGCID, Beryllium, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, LIGASE
Deposited on 2017-05-21, released 2017-05-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-31, with a file datestamp of 2017-05-26.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UDP-N-acetylmuramate--L-alanine ligase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: murC, PA4411
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HW02 (8-End)
      • expression tag (7)
    Domains in SCOPe 2.07: d5vvwa1, d5vvwa2, d5vvwa3
  • Chain 'B':
    Compound: UDP-N-acetylmuramate--L-alanine ligase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: murC, PA4411
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HW02 (8-End)
      • expression tag (7)
    Domains in SCOPe 2.07: d5vvwb1, d5vvwb2, d5vvwb3
  • Chain 'C':
    Compound: UDP-N-acetylmuramate--L-alanine ligase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: murC, PA4411
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HW02 (8-End)
      • expression tag (7)
    Domains in SCOPe 2.07: d5vvwc1, d5vvwc2, d5vvwc3
  • Chain 'D':
    Compound: UDP-N-acetylmuramate--L-alanine ligase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: murC, PA4411
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HW02 (8-End)
      • expression tag (7)
    Domains in SCOPe 2.07: d5vvwd1, d5vvwd2, d5vvwd3
  • Chain 'E':
    Compound: UDP-N-acetylmuramate--L-alanine ligase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: murC, PA4411
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HW02 (8-End)
      • expression tag (7)
    Domains in SCOPe 2.07: d5vvwe1, d5vvwe2, d5vvwe3
  • Chain 'F':
    Compound: UDP-N-acetylmuramate--L-alanine ligase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: murC, PA4411
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HW02 (8-End)
      • expression tag (7)
    Domains in SCOPe 2.07: d5vvwf1, d5vvwf2, d5vvwf3
  • Chain 'G':
    Compound: UDP-N-acetylmuramate--L-alanine ligase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: murC, PA4411
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HW02 (8-End)
      • expression tag (7)
    Domains in SCOPe 2.07: d5vvwg1, d5vvwg2, d5vvwg3
  • Chain 'H':
    Compound: UDP-N-acetylmuramate--L-alanine ligase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: murC, PA4411
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HW02 (8-End)
      • expression tag (7)
    Domains in SCOPe 2.07: d5vvwh1, d5vvwh2, d5vvwh3
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vvwA (A:)
    mahhhhhhrrihfvgiggagmcgiaevllnlgyevsgsdlkasavterlekfgaqifigh
    qaenadgadvlvvssainranpevasalerripvvpraemlaelmryrhgiavagthgkt
    tttsliasvfaaggldptfviggrlnaagtnaqlgasrylvaeadesdasflhlqpmvav
    vtnidadhmatyggdfnklkktfveflhnlpfyglavmcvddpvvreilpqiarptvtyg
    lsedadvrainirqegmrtwftvlrperepldvsvnmpglhnvlnslativiatdegisd
    eaivqglsgfqgvgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vvwA (A:)
    hrrihfvgiggagmcgiaevllnlgyevsgsdlkasavterlekfgaqifighqaenadg
    advlvvssainranpevasalerripvvpraemlaelmryrhgiavagthgkttttslia
    svfaaggldptfviggrlnaagtnaqlgasrylvaeadesdasflhlqpmvavvtnidad
    hmatyggdfnklkktfveflhnlpfyglavmcvddpvvreilpqiarptvtyglsedadv
    rainirqegmrtwftvlrperepldvsvnmpglhnvlnslativiatdegisdeaivqgl
    sgfqg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5vvwB (B:)
    mahhhhhhrrihfvgiggagmcgiaevllnlgyevsgsdlkasavterlekfgaqifigh
    qaenadgadvlvvssainranpevasalerripvvpraemlaelmryrhgiavagthgkt
    tttsliasvfaaggldptfviggrlnaagtnaqlgasrylvaeadesdasflhlqpmvav
    vtnidadhmatyggdfnklkktfveflhnlpfyglavmcvddpvvreilpqiarptvtyg
    lsedadvrainirqegmrtwftvlrperepldvsvnmpglhnvlnslativiatdegisd
    eaivqglsgfqgvgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vvwB (B:)
    hrrihfvgiggagmcgiaevllnlgyevsgsdlkasavterlekfgaqifighqaenadg
    advlvvssainranpevasalerripvvpraemlaelmryrhgiavagthgkttttslia
    svfaaggldptfviggrlnaagtnaqlgasrylvaeadesdasflhlqpmvavvtnidad
    hmatyggdfnklkktfveflhnlpfyglavmcvddpvvreilpqiarptvtyglsedadv
    rainirqegmrtwftvlrperepldvsvnmpglhnvlnslativiatdegisdeaivqgl
    sgfqg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5vvwC (C:)
    mahhhhhhrrihfvgiggagmcgiaevllnlgyevsgsdlkasavterlekfgaqifigh
    qaenadgadvlvvssainranpevasalerripvvpraemlaelmryrhgiavagthgkt
    tttsliasvfaaggldptfviggrlnaagtnaqlgasrylvaeadesdasflhlqpmvav
    vtnidadhmatyggdfnklkktfveflhnlpfyglavmcvddpvvreilpqiarptvtyg
    lsedadvrainirqegmrtwftvlrperepldvsvnmpglhnvlnslativiatdegisd
    eaivqglsgfqgvgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vvwC (C:)
    hrrihfvgiggagmcgiaevllnlgyevsgsdlkasavterlekfgaqifighqaenadg
    advlvvssainranpevasalerripvvpraemlaelmryrhgiavagthgkttttslia
    svfaaggldptfviggrlnaagtnaqlgasrylvaeadesdasflhlqpmvavvtnidad
    hmatyggdfnklkktfveflhnlpfyglavmcvddpvvreilpqiarptvtyglsedadv
    rainirqegmrtwftvlrperepldvsvnmpglhnvlnslativiatdegisdeaivqgl
    sgfqg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5vvwD (D:)
    mahhhhhhrrihfvgiggagmcgiaevllnlgyevsgsdlkasavterlekfgaqifigh
    qaenadgadvlvvssainranpevasalerripvvpraemlaelmryrhgiavagthgkt
    tttsliasvfaaggldptfviggrlnaagtnaqlgasrylvaeadesdasflhlqpmvav
    vtnidadhmatyggdfnklkktfveflhnlpfyglavmcvddpvvreilpqiarptvtyg
    lsedadvrainirqegmrtwftvlrperepldvsvnmpglhnvlnslativiatdegisd
    eaivqglsgfqgvgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vvwD (D:)
    hrrihfvgiggagmcgiaevllnlgyevsgsdlkasavterlekfgaqifighqaenadg
    advlvvssainranpevasalerripvvpraemlaelmryrhgiavagthgkttttslia
    svfaaggldptfviggrlnaagtnaqlgasrylvaeadesdasflhlqpmvavvtnidad
    hmatyggdfnklkktfveflhnlpfyglavmcvddpvvreilpqiarptvtyglsedadv
    rainirqegmrtwftvlrperepldvsvnmpglhnvlnslativiatdegisdeaivqgl
    sgfqg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5vvwE (E:)
    mahhhhhhrrihfvgiggagmcgiaevllnlgyevsgsdlkasavterlekfgaqifigh
    qaenadgadvlvvssainranpevasalerripvvpraemlaelmryrhgiavagthgkt
    tttsliasvfaaggldptfviggrlnaagtnaqlgasrylvaeadesdasflhlqpmvav
    vtnidadhmatyggdfnklkktfveflhnlpfyglavmcvddpvvreilpqiarptvtyg
    lsedadvrainirqegmrtwftvlrperepldvsvnmpglhnvlnslativiatdegisd
    eaivqglsgfqgvgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vvwE (E:)
    hrrihfvgiggagmcgiaevllnlgyevsgsdlkasavterlekfgaqifighqaenadg
    advlvvssainranpevasalerripvvpraemlaelmryrhgiavagthgkttttslia
    svfaaggldptfviggrlnaagtnaqlgasrylvaeadesdasflhlqpmvavvtnidad
    hmatyggdfnklkktfveflhnlpfyglavmcvddpvvreilpqiarptvtyglsedadv
    rainirqegmrtwftvlrperepldvsvnmpglhnvlnslativiatdegisdeaivqgl
    sgfq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5vvwF (F:)
    mahhhhhhrrihfvgiggagmcgiaevllnlgyevsgsdlkasavterlekfgaqifigh
    qaenadgadvlvvssainranpevasalerripvvpraemlaelmryrhgiavagthgkt
    tttsliasvfaaggldptfviggrlnaagtnaqlgasrylvaeadesdasflhlqpmvav
    vtnidadhmatyggdfnklkktfveflhnlpfyglavmcvddpvvreilpqiarptvtyg
    lsedadvrainirqegmrtwftvlrperepldvsvnmpglhnvlnslativiatdegisd
    eaivqglsgfqgvgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vvwF (F:)
    hrrihfvgiggagmcgiaevllnlgyevsgsdlkasavterlekfgaqifighqaenadg
    advlvvssainranpevasalerripvvpraemlaelmryrhgiavagthgkttttslia
    svfaaggldptfviggrlnaagtnaqlgasrylvaeadesdasflhlqpmvavvtnidad
    hmatyggdfnklkktfveflhnlpfyglavmcvddpvvreilpqiarptvtyglsedadv
    rainirqegmrtwftvlrperepldvsvnmpglhnvlnslativiatdegisdeaivqgl
    sgfqg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5vvwG (G:)
    mahhhhhhrrihfvgiggagmcgiaevllnlgyevsgsdlkasavterlekfgaqifigh
    qaenadgadvlvvssainranpevasalerripvvpraemlaelmryrhgiavagthgkt
    tttsliasvfaaggldptfviggrlnaagtnaqlgasrylvaeadesdasflhlqpmvav
    vtnidadhmatyggdfnklkktfveflhnlpfyglavmcvddpvvreilpqiarptvtyg
    lsedadvrainirqegmrtwftvlrperepldvsvnmpglhnvlnslativiatdegisd
    eaivqglsgfqgvgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vvwG (G:)
    hrrihfvgiggagmcgiaevllnlgyevsgsdlkasavterlekfgaqifighqaenadg
    advlvvssainranpevasalerripvvpraemlaelmryrhgiavagthgkttttslia
    svfaaggldptfviggrlnaagtnaqlgasrylvaeadesdasflhlqpmvavvtnidad
    hmatyggdfnklkktfveflhnlpfyglavmcvddpvvreilpqiarptvtyglsedadv
    rainirqegmrtwftvlrperepldvsvnmpglhnvlnslativiatdegisdeaivqgl
    sgfqg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5vvwH (H:)
    mahhhhhhrrihfvgiggagmcgiaevllnlgyevsgsdlkasavterlekfgaqifigh
    qaenadgadvlvvssainranpevasalerripvvpraemlaelmryrhgiavagthgkt
    tttsliasvfaaggldptfviggrlnaagtnaqlgasrylvaeadesdasflhlqpmvav
    vtnidadhmatyggdfnklkktfveflhnlpfyglavmcvddpvvreilpqiarptvtyg
    lsedadvrainirqegmrtwftvlrperepldvsvnmpglhnvlnslativiatdegisd
    eaivqglsgfqgvgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vvwH (H:)
    hrrihfvgiggagmcgiaevllnlgyevsgsdlkasavterlekfgaqifighqaenadg
    advlvvssainranpevasalerripvvpraemlaelmryrhgiavagthgkttttslia
    svfaaggldptfviggrlnaagtnaqlgasrylvaeadesdasflhlqpmvavvtnidad
    hmatyggdfnklkktfveflhnlpfyglavmcvddpvvreilpqiarptvtyglsedadv
    rainirqegmrtwftvlrperepldvsvnmpglhnvlnslativiatdegisdeaivqgl
    sgfqg