PDB entry 5vt9

View 5vt9 on RCSB PDB site
Description: Myosin Light chain 1 and MyoA complex
Class: motor protein
Keywords: Myosin light chain, MOTOR PROTEIN
Deposited on 2017-05-16, released 2017-10-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myosin light chain TgMLC1
    Species: Toxoplasma gondii [TaxId:5811]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5vt9a_
  • Chain 'B':
    Compound: Myosin light chain TgMLC1
    Species: Toxoplasma gondii [TaxId:5811]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q95UJ7 (Start-148)
      • expression tag (149)
    Domains in SCOPe 2.06: d5vt9b1, d5vt9b2
  • Chain 'C':
    Compound: Myosin-A
    Species: Toxoplasma gondii [TaxId:5811]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Myosin-A
    Species: Toxoplasma gondii [TaxId:5811]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vt9A (A:)
    gsmgadedmqealeemveademyarfnarasggkvstgdamilarqlglapsyadkqafe
    eksgdnldyasfqkfvgtsthpedniedlveafayfdvskhgyltrkqmgnilmtygepl
    tteefnalaaeyftsdqidyrqfckamleaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vt9A (A:)
    mveademyarfnarasggkvstgdamilarqlglapsyadkqafeeksgdnldyasfqkf
    vgtsthpedniedlveafayfdvskhgyltrkqmgnilmtygepltteefnalaaeyfts
    dqidyrqfckamle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5vt9B (B:)
    gsmgadedmqealeemveademyarfnarasggkvstgdamilarqlglapsyadkqafe
    eksgdnldyasfqkfvgtsthpedniedlveafayfdvskhgyltrkqmgnilmtygepl
    tteefnalaaeyftsdqidyrqfckamleaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vt9B (B:)
    aleemveademyarfnarasggkvstgdamilarqlglapsyadkqafeeksgdnldyas
    fqkfvgtsthpedniedlveafayfdvskhgyltrkqmgnilmtygepltteefnalaae
    yftsdqidyrqfckamlea
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.