PDB entry 5vsu

View 5vsu on RCSB PDB site
Description: Structure of yeast U6 snRNP with 2'-phosphate terminated U6 RNA
Class: splicing
Keywords: Lsm2-8 spliceosome U6 Prp24, SPLICING
Deposited on 2017-05-12, released 2018-05-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-09, with a file datestamp of 2018-05-04.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: U4/U6 snRNA-associated-splicing factor PRP24
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: PRP24, YMR268C, YM8156.10C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49960 (Start-443)
      • expression tag (444)
  • Chain 'B':
    Compound: u6 snrna-associated sm-like protein lsm2
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: LSM2, SMX5, SNP3, YBL026W, YBL0425
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38203 (3-97)
      • initiating methionine (0)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d5vsub_
  • Chain 'C':
    Compound: U6 snRNA-associated Sm-like protein LSm3
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: LSM3, SMX4, USS2, YLR438C-A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P57743 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d5vsuc1, d5vsuc2
  • Chain 'D':
    Compound: u6 snrna-associated sm-like protein lsm4
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: LSM4, SDB23, USS1, YER112W
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: U6 snRNA-associated Sm-like protein LSm5
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: LSM5, YER146W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vsue_
  • Chain 'F':
    Compound: U6 snRNA-associated Sm-like protein LSm6
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: LSM6, YDR378C, D9481.18
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vsuf_
  • Chain 'G':
    Compound: U6 snRNA-associated Sm-like protein LSm7
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: LSM7, YNL147W, N1202, N1780
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vsug_
  • Chain 'H':
    Compound: U6 snRNA-associated Sm-like protein LSm8
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: LSM8, YJR022W, J1464, YJR83.16
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Saccharomyces cerevisiae strain T8 chromosome XII sequence
    Species: Saccharomyces cerevisiae [TaxId:4932]

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5vsuB (B:)
    mgsmlffsffktlvdqevvvelkndieikgtlqsvdqflnlkldnisctdekkyphlgsv
    rnifirgstvryvylnknmvdtnllqdatrrevmterk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5vsuC (C:)
    mgsmetpldllklnldervyiklrgartlvgtlqafdshcnivlsdavetiyqlnneels
    eserrcemvfirgdtvtlistpsedddgavei
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vsuC (C:)
    gsmetpldllklnldervyiklrgartlvgtlqafdshcnivlsdavetiyqlnneelse
    serrcemvfirgdtvtlistp
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5vsuE (E:)
    mgsmslpeilplevidktinqkvlivlqsnrefegtlvgfddfvnviledavewlidped
    esrnekvmqhhgrmllsgnniailvpggkktpteal
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vsuE (E:)
    mslpeilplevidktinqkvlivlqsnrefegtlvgfddfvnviledavewlidpedesr
    nekvmqhhgrmllsgnniailvpggkk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5vsuF (F:)
    gsmsgkastegsvtteflsdiigktvnvklasgllysgrlesidgfmnvalssatehyes
    nnnkllnkfnsdvflrgtqvmyiseqki
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vsuF (F:)
    svtteflsdiigktvnvklasgllysgrlesidgfmnvalssatehyesnnnkllnkfns
    dvflrgtqvmyiseqki
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5vsuG (G:)
    mgsmhqqhsksenkpqqqrkkfegpkreaildlakykdskirvklmggklvigvlkgydq
    lmnlvlddtveymsnpddenntelisknarklgltvirgtilvslssaegsdvlymqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vsuG (G:)
    aildlakykdskirvklmggklvigvlkgydqlmnlvlddtveymsisknarklgltvir
    gtilvslssa
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.