PDB entry 5vqk

View 5vqk on RCSB PDB site
Description: X-ray co-structure of nuclear receptor ROR-gammat Ligand Binding Domain with a inverse agonist and SRC2 peptide
Class: transcription
Keywords: nuclear receptor, nuclear hormone receptor, transcription
Deposited on 2017-05-09, released 2018-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-16, with a file datestamp of 2018-05-11.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor ROR-gamma, SRC2 chimera
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51449 (Start-263)
    • PDB 5VQK (264-279)
    Domains in SCOPe 2.07: d5vqka1, d5vqka2
  • Heterogens: 9GV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vqkA (A:)
    mgsshhhhhhlvprgspeapyaslteiehlvqsvcksyretcqlrledllrqrsnifsre
    evtgyqrksmwemwercahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlv
    rmcraynadnrtvffegkyggmelfralgcselissifdfshslsalhfsedeialytal
    vlinahrpglqekrkveqlqynlelafhhhlckthrqsilaklppkgklrslcsqhverl
    qifqhlhpivvqaafpplykelfsgggekhkilhrllqds
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vqkA (A:)
    aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
    teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
    melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
    nlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpplyke
    lfsgkhkilhrllqds