PDB entry 5vpz

View 5vpz on RCSB PDB site
Description: Crystal structure of human KRAS G12A mutant in complex with GTP-gamma-S
Class: hydrolase
Keywords: Oncogenic mutant, HYDROLASE
Deposited on 2017-05-06, released 2017-12-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (1-169)
      • expression tag (0)
      • engineered mutation (12)
      • engineered mutation (118)
    Domains in SCOPe 2.06: d5vpza1, d5vpza2
  • Chain 'B':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (1-169)
      • expression tag (0)
      • engineered mutation (12)
      • engineered mutation (118)
    Domains in SCOPe 2.06: d5vpzb1, d5vpzb2
  • Heterogens: MG, GSP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vpzA (A:)
    hmteyklvvvgaagvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildta
    gqeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnksd
    lpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vpzA (A:)
    hmteyklvvvgaagvgksaltiqliqnhfvdeydpdsyrkqvvidgetclldildtadqy
    mrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnksdlpsrtvdtkqaq
    dlarsygipfietsaktrqgvddafytlvreirkhkek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5vpzB (B:)
    hmteyklvvvgaagvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildta
    gqeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnksd
    lpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vpzB (B:)
    hmteyklvvvgaagvgksaltiqliqnhfvdeydpdsyrkqvvidgetclldildtadqy
    mrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnksdlpsrtvdtkqaq
    dlarsygipfietsaktrqgvddafytlvreirkhkek