PDB entry 5vn5

View 5vn5 on RCSB PDB site
Description: Crystal structure of LigY from Sphingobium sp. strain SYK-6
Class: hydrolase
Keywords: amidohydrolase, lignin degradation, meta-cleavage product hydrolase, HYDROLASE
Deposited on 2017-04-28, released 2017-09-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2,2',3-trihydroxy-3'-methoxy-5,5'-dicarboxybiphenyl meta-cleavage compound hydrolase
    Species: Sphingobium sp. SYK-6 [TaxId:627192]
    Gene: ligY, SLG_07750
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vn5a_
  • Chain 'B':
    Compound: 2,2',3-trihydroxy-3'-methoxy-5,5'-dicarboxybiphenyl meta-cleavage compound hydrolase
    Species: Sphingobium sp. SYK-6 [TaxId:627192]
    Gene: ligY, SLG_07750
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vn5b_
  • Chain 'C':
    Compound: 2,2',3-trihydroxy-3'-methoxy-5,5'-dicarboxybiphenyl meta-cleavage compound hydrolase
    Species: Sphingobium sp. SYK-6 [TaxId:627192]
    Gene: ligY, SLG_07750
    Database cross-references and differences (RAF-indexed):
    • Uniprot G2IN02 (0-331)
      • expression tag (332-333)
    Domains in SCOPe 2.07: d5vn5c1, d5vn5c2
  • Heterogens: ZN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vn5A (A:)
    miidchghvsapvelwaykasllahrgshgrggvkvtdeqiiaaahhketwpdghiellh
    nhgtdmqlisprpfqmmnsakparvvhwfceevntlihrqctlipemfipvaglpqvage
    pienvfaemdrcvsmgfkgfllnpdpyengaeeapplgdrywyplyeklceldlpahiha
    tgsqserspyslhfineetiatynlctssvfddfpqlkvvvshgggaipyqlgrfesqsr
    rskhlfsermaklyfdtvlytegalrllietvgperclfgsecpgvgstidpatgkqmdh
    iapfiqkfdflsdadkklifednarkvfnlevenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vn5A (A:)
    miidchghvsapvelwaykasllahrgshgrggvkvtdeqiiaaahhketwpdghiellh
    nhgtdmqlisprpfqmmnsakparvvhwfceevntlihrqctlipemfipvaglpqvage
    pienvfaemdrcvsmgfkgfllnpdpyengaeeapplgdrywyplyeklceldlpahiha
    tgsqserspyslhfineetiatynlctssvfddfpqlkvvvshgggaipyqlgrfesqsr
    rskhlfsermaklyfdtvlytegalrllietvgperclfgsecpgvgstidpatgkqmdh
    iapfiqkfdflsdadkklifednarkvfnlev
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5vn5B (B:)
    miidchghvsapvelwaykasllahrgshgrggvkvtdeqiiaaahhketwpdghiellh
    nhgtdmqlisprpfqmmnsakparvvhwfceevntlihrqctlipemfipvaglpqvage
    pienvfaemdrcvsmgfkgfllnpdpyengaeeapplgdrywyplyeklceldlpahiha
    tgsqserspyslhfineetiatynlctssvfddfpqlkvvvshgggaipyqlgrfesqsr
    rskhlfsermaklyfdtvlytegalrllietvgperclfgsecpgvgstidpatgkqmdh
    iapfiqkfdflsdadkklifednarkvfnlevenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vn5B (B:)
    miidchghvsapvelwaykasllahrgshgrggvkvtdeqiiaaahhketwpdghiellh
    nhgtdmqlisprpfqmmnsakparvvhwfceevntlihrqctlipemfipvaglpqvage
    pienvfaemdrcvsmgfkgfllnpdpyengaeeapplgdrywyplyeklceldlpahiha
    tgsqserspyslhfineetiatynlctssvfddfpqlkvvvshgggaipyqlgrfesqsr
    rskhlfsermaklyfdtvlytegalrllietvgperclfgsecpgvgstidpatgkqmdh
    iapfiqkfdflsdadkklifednarkvfnlev
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5vn5C (C:)
    miidchghvsapvelwaykasllahrgshgrggvkvtdeqiiaaahhketwpdghiellh
    nhgtdmqlisprpfqmmnsakparvvhwfceevntlihrqctlipemfipvaglpqvage
    pienvfaemdrcvsmgfkgfllnpdpyengaeeapplgdrywyplyeklceldlpahiha
    tgsqserspyslhfineetiatynlctssvfddfpqlkvvvshgggaipyqlgrfesqsr
    rskhlfsermaklyfdtvlytegalrllietvgperclfgsecpgvgstidpatgkqmdh
    iapfiqkfdflsdadkklifednarkvfnlevenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vn5C (C:)
    miidchghvsapvelwaykasllahrgshgrggvkvtdeqiiaaahhketwpdghiellh
    nhgtdmqlisprpfqmmnsakparvvhwfceevntlihrqctlipemfipvaglpqvage
    pienvfaemdrcvsmgfkgfllnpdpyengaeeapplgdrywyplyeklceldlpahiha
    tgsqserspyslhfineetiatynlctssvfddfpqlkvvvshgggaipyqlgrfesqsr
    rskhlfsermaklyfdtvlytegalrllietvgperclfgsecpgvgstidpatgkqmdh
    iapfiqkfdflsdadkklifednarkvfnleven