PDB entry 5vk6

View 5vk6 on RCSB PDB site
Description: Open conformation of KcsA non-inactivating E71A mutant
Class: immune system/transport protein
Keywords: KcsA, open, non-inactivating, potassium channel, IMMUNE SYSTEM-TRANSPORT PROTEIN complex
Deposited on 2017-04-21, released 2017-12-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antibody heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5VK6 (0-218)
    Domains in SCOPe 2.06: d5vk6a1, d5vk6a2
  • Chain 'B':
    Compound: Antibody Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5VK6 (0-211)
    Domains in SCOPe 2.06: d5vk6b1, d5vk6b2
  • Chain 'C':
    Compound: pH-gated potassium channel KcsA
    Species: Streptomyces lividans [TaxId:1916]
    Gene: kcsA, skc1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334 (0-95)
      • conflict (2)
      • conflict (45)
      • conflict (64)
      • conflict (91-92)
      • conflict (94-95)
    Domains in SCOPe 2.06: d5vk6c_
  • Heterogens: F09, 1EM, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5vk6A (A:)
    qvqlqqpgaelvkpgasvklsckasgytftsdwihwvkqrpghglewigeiipsygrany
    nekiqkkatltadkssstafmqlssltsedsavyycarergdgyfavwgagttvtvssak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpssswpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5vk6B (B:)
    dilltqspailsvspgervsfscrasqsigtdihwyqqrtngsprllikyasesisgips
    rfsgsgsgtdftlsinsvesedianyycqqsnrwpftfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5vk6C (C:)
    wrcagaatvllvivllagsylavlaergapgaqlitypralwwsvatattvgygdlypvt
    lwgrcvavvvmvagitsfglvtaalatwfvgqcqqq