PDB entry 5vic

View 5vic on RCSB PDB site
Description: Crystal structure of anti-Zika antibody Z004 bound to DENV-1 Envelope protein DIII
Class: immune system
Keywords: antibody, Fab, Zika, Dengue, recurrent, neutralizing, immune system
Deposited on 2017-04-14, released 2017-05-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-05-03, with a file datestamp of 2017-04-28.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: Dengue 1 Envelope DIII domain
    Species: Dengue virus type 1 (strain Nauru/West Pac/1974) [TaxId:11059]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5vice_
  • Chain 'H':
    Compound: Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5VIC (0-110)
    • Uniprot S6B291 (111-End)
  • Chain 'L':
    Compound: Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5VIC (0-107)
    • Uniprot P0DOX7 (108-End)
    Domains in SCOPe 2.06: d5vicl1, d5vicl2

PDB Chain Sequences:

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5vicE (E:)
    syvmctgsfklekevaetqhgtvlvqvkyegtdapckipfssqdekgvtqngrlitanpi
    vtdkekpvnieaeppfgesyivvgagekalklswfkkgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vicE (E:)
    syvmctgsfklekevaegtvlvqvkyegtdapckipfssqngrlitanpivtdkekpvni
    eaeppesyivvgagekalklswf
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5vicL (L:)
    diqmtqspstlsasvgdrvtitcrasqsiskwlawyqqkpgkapklliyttstlksgvps
    rfsgsgsgteftltisslqpddfatyycqhfysvpwtfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vicL (L:)
    diqmtqspstlsasvgdrvtitcrasqsiskwlawyqqkpgkapklliyttstlksgvps
    rfsgsgsgteftltisslqpddfatyycqhfysvpwtfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnr