PDB entry 5vg0

View 5vg0 on RCSB PDB site
Description: Room temperature X-ray crystallographic structure of a Jonesia denitrificans lytic polysaccharide monooxygenase at 1.1 angstrom resolution.
Class: sugar binding protein
Keywords: histidine brace, HYDROLASE, SUGAR BINDING PROTEIN
Deposited on 2017-04-10, released 2017-05-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-05-24, with a file datestamp of 2017-05-19.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chitinase
    Species: Jonesia denitrificans (strain ATCC 14870 / DSM 20603 / CIP 55134) [TaxId:471856]
    Gene: Jden_1381
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5vg0a_
  • Chain 'B':
    Compound: chitinase
    Species: Jonesia denitrificans (strain ATCC 14870 / DSM 20603 / CIP 55134) [TaxId:471856]
    Gene: Jden_1381
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5vg0b_
  • Heterogens: CU, PER, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5vg0A (A:)
    hgwvtdppsrqalcasgetsfdcgqisyepqsveapkgattcsggneafailddnskpwp
    tteiastvdltwkltaphntstweyfvdgqlhqtfdqkgqqpptslthtltdlptgehti
    larwnvsntnnafyncmdvvvs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5vg0B (B:)
    hgwvtdppsrqalcasgetsfdcgqisyepqsveapkgattcsggneafailddnskpwp
    tteiastvdltwkltaphntstweyfvdgqlhqtfdqkgqqpptslthtltdlptgehti
    larwnvsntnnafyncmdvvvs