PDB entry 5vf6

View 5vf6 on RCSB PDB site
Description: Crystal structure of single chain variable fragment (scFv45).
Class: immune system
Keywords: single chain variable fragment, scFv, conformation-sensor antibodies, intrabodies, IMMUNE SYSTEM
Deposited on 2017-04-06, released 2018-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: single chain variable fragment
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • PDB 5VF6
    Domains in SCOPe 2.07: d5vf6a1, d5vf6a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vf6A (A:)
    altqpssvsanpggtvkitcsgsssaygygwyqqkspgsapvtviynnnkrpsnipsrfs
    gsksgstgtltitgvqaedeavyfcgsedsstdaifgagttltvlgqssrsssgggssgg
    ggstvtldesggglqapggalslvckasgftfssydmgwirqapgkgleyvagitdngry
    asygsavdgratisrdngqssvrlqlnnlraedtgtyycarddgsgwtgnsidawghgte
    vivsenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vf6A (A:)
    ltqpssvsanpggtvkitcsgsssaygygwyqqkspgsapvtviynnnkrpsnipsrfsg
    sksgstgtltitgvqaedeavyfcgsedsstdaifgagttltvlgqvtldesggglqapg
    galslvckasgftfssydmgwirqapgkgleyvagitdngryasygsavdgratisrdng
    qssvrlqlnnlraedtgtyycarddgsgwtgnsidawghgtevivs