PDB entry 5vev

View 5vev on RCSB PDB site
Description: Crystal Structure of Phosphoribosylamine-glycine Ligase from Neisseria gonorrhoeae
Class: ligase
Keywords: SSGCID, Neisseria gonorrhoeae, Phosphoribosylamine--glycine ligase, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, LIGASE
Deposited on 2017-04-05, released 2017-04-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-04-12, with a file datestamp of 2017-04-07.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoribosylamine--glycine ligase
    Species: Neisseria gonorrhoeae (strain NCCP11945) [TaxId:521006]
    Gene: purD, NGK_2312
    Database cross-references and differences (RAF-indexed):
    • Uniprot B4RPN9 (8-430)
      • expression tag (6-7)
      • engineered mutation (218)
    Domains in SCOPe 2.06: d5veva1, d5veva2, d5veva3, d5veva4
  • Chain 'B':
    Compound: Phosphoribosylamine--glycine ligase
    Species: Neisseria gonorrhoeae (strain NCCP11945) [TaxId:521006]
    Gene: purD, NGK_2312
    Database cross-references and differences (RAF-indexed):
    • Uniprot B4RPN9 (8-End)
      • expression tag (5-7)
      • engineered mutation (218)
    Domains in SCOPe 2.06: d5vevb1, d5vevb2, d5vevb3, d5vevb4
  • Heterogens: NA, ACT, EDO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vevA (A:)
    mahhhhhhmkllvignggrehalawklaqspkvetvfvapgnagtaiesklqnialtayq
    dliefcrkenivftvvgpeaplaagivddfraaglkifgptqyaaqlesskdfakafmvk
    yniptaqyqtfenadaahdyvnqkgapivikadglvagkgvivamtldeahaaiddmllg
    nkmgnagervviedflqgeeasfivmvdgnhvlpmatsqdhkrlldgdkgpntggmgays
    papvvtpavyeramneiilptvagmkaegheftgflyaglmidqsgapytiefncrfgdp
    etqpimsrlnsdladlveaaidgrldsvkaewnpqtavgvvlaaqnypetpkkgdvisgl
    ddvnrigkvfhagttvnekgdvltnggrilcvvglgddvaqakakaygalekisfdgmqy
    rkdiadkainr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vevA (A:)
    hhmkllvignggrehalawklaqspkvetvfvapgnagtaiesklqnialtayqdliefc
    rkenivftvvgpeaplaagivddfraaglkifgptqyaaqlesskdfakafmvkynipta
    qyqtfenadaahdyvnqkgapivikavivamtldeahaaiddmrvviedflqgeeasfiv
    mvdgnhvlpmatsqdhkrlldgdkgpntggmgayspapvvtpavyeramneiilptvagm
    kaegheftgflyaglmidqsgapytiefncrfgdpetqpimsrlnsdladlveaaidgrl
    dsvkaewnpqtavgvvlaaqnypetpkkgdvisglddvnrigkvfhagttvnekgdvltn
    ggrilcvvglgddvaqakakaygalekisfdgmqyrkdiadkainr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5vevB (B:)
    mahhhhhhmkllvignggrehalawklaqspkvetvfvapgnagtaiesklqnialtayq
    dliefcrkenivftvvgpeaplaagivddfraaglkifgptqyaaqlesskdfakafmvk
    yniptaqyqtfenadaahdyvnqkgapivikadglvagkgvivamtldeahaaiddmllg
    nkmgnagervviedflqgeeasfivmvdgnhvlpmatsqdhkrlldgdkgpntggmgays
    papvvtpavyeramneiilptvagmkaegheftgflyaglmidqsgapytiefncrfgdp
    etqpimsrlnsdladlveaaidgrldsvkaewnpqtavgvvlaaqnypetpkkgdvisgl
    ddvnrigkvfhagttvnekgdvltnggrilcvvglgddvaqakakaygalekisfdgmqy
    rkdiadkainr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vevB (B:)
    hhhmkllvignggrehalawklaqspkvetvfvapgnagtaiesklqnialtayqdlief
    crkenivftvvgpeaplaagivddfraaglkifgptqyaaqlesskdfakafmvkynipt
    aqyqtfenadaahdyvnqkgapivikavivamtldeahaaiddmlervviedflqgeeas
    fivmvdgnhvlpmatsqdhkrlldgdkgpntggmgayspapvvtpavyeramneiilptv
    agmkaegheftgflyaglmidqsgapytiefncrfgdpetqpimsrlnsdladlveaaid
    grldsvkaewnpqtavgvvlaaqnypetpkkgdvisglddvnrigkvfhagttvnekgdv
    ltnggrilcvvglgddvaqakakaygalekisfdgmqyrkdiadkai