PDB entry 5veu

View 5veu on RCSB PDB site
Description: Human Cytochrome P450 3A5 (CYP3A5)
Class: OXIDOREDUCTASE/OXIDOREDUCTASE inhibitor
Keywords: Inhibitor, Complex, Cytochrome P450, ritonavir, CYP3A5, OXIDOREDUCTASE-OXIDOREDUCTASE inhibitor complex
Deposited on 2017-04-05, released 2017-11-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 2.91 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450 3A5
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP3A5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5veua_
  • Chain 'B':
    Compound: Cytochrome P450 3A5
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP3A5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5veub_
  • Chain 'C':
    Compound: Cytochrome P450 3A5
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP3A5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5veuc_
  • Chain 'D':
    Compound: Cytochrome P450 3A5
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP3A5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5veud_
  • Chain 'E':
    Compound: Cytochrome P450 3A5
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP3A5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5veue_
  • Chain 'F':
    Compound: Cytochrome P450 3A5
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP3A5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5veuf_
  • Chain 'G':
    Compound: Cytochrome P450 3A5
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP3A5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5veug_
  • Chain 'H':
    Compound: Cytochrome P450 3A5
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP3A5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5veuh_
  • Chain 'I':
    Compound: Cytochrome P450 3A5
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP3A5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5veui_
  • Chain 'J':
    Compound: Cytochrome P450 3A5
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP3A5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5veuj_
  • Chain 'K':
    Compound: Cytochrome P450 3A5
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP3A5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5veuk_
  • Chain 'L':
    Compound: Cytochrome P450 3A5
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP3A5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5veul_
  • Heterogens: HEM, RIT

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5veuA (A:)
    malygtrthglfkrlgipgptplpllgnvlsyrqglwkfdtecykkygkmwgtyegqlpv
    laitdpdvirtvlvkecysvftnrrslgpvgfmksaislaedeewkrirsllsptftsgk
    lkemfpiiaqygdvlvrnlrreaekgkpvtlkdifgaysmdvitgtsfgvnidslnnpqd
    pfvestkkflkfgfldplflsiilfpfltpvfealnvslfpkdtinflsksvnrmkksrl
    ndkqkhrldflqlmidsqnsketeshkalsdlelaaqsiififagyettssvlsftlyel
    athpdvqqklqkeidavlpnkapptydavvqmeyldmvvnetlrlfpvairlertckkdv
    eingvfipkgsmvviptyalhhdpkywtepeefrperfskkkdsidpyiytpfgtgprnc
    igmrfalmnmklalirvlqnfsfkpcketqiplkldtqgllqpekpivlkvdsrdghhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5veuA (A:)
    trthglfkrlgipgptplpllgnvlsyrqglwkfdtecykkygkmwgtyegqlpvlaitd
    pdvirtvlvkecysvftnrrslgpvgfmksaislaedeewkrirsllsptftsgklkemf
    piiaqygdvlvrnlrreaekgkpvtlkdifgaysmdvitgtsfgvnidslnnpqdpfves
    tkkflkfgfldplflsiilfpfltpvfealnvslfpkdtinflsksvnrmkksrlndkqk
    hrldflqlmidsqnsalsdlelaaqsiififagyettssvlsftlyelathpdvqqklqk
    eidavlpnkapptydavvqmeyldmvvnetlrlfpvairlertckkdveingvfipkgsm
    vviptyalhhdpkywtepeefrperfskkkdsidpyiytpfgtgprncigmrfalmnmkl
    alirvlqnfsfkpcketqiplkldtqgllqpekpivlkvdsr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5veuB (B:)
    malygtrthglfkrlgipgptplpllgnvlsyrqglwkfdtecykkygkmwgtyegqlpv
    laitdpdvirtvlvkecysvftnrrslgpvgfmksaislaedeewkrirsllsptftsgk
    lkemfpiiaqygdvlvrnlrreaekgkpvtlkdifgaysmdvitgtsfgvnidslnnpqd
    pfvestkkflkfgfldplflsiilfpfltpvfealnvslfpkdtinflsksvnrmkksrl
    ndkqkhrldflqlmidsqnsketeshkalsdlelaaqsiififagyettssvlsftlyel
    athpdvqqklqkeidavlpnkapptydavvqmeyldmvvnetlrlfpvairlertckkdv
    eingvfipkgsmvviptyalhhdpkywtepeefrperfskkkdsidpyiytpfgtgprnc
    igmrfalmnmklalirvlqnfsfkpcketqiplkldtqgllqpekpivlkvdsrdghhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5veuB (B:)
    trthglfkrlgipgptplpllgnvlsyrqglwkfdtecykkygkmwgtyegqlpvlaitd
    pdvirtvlvkecysvftnrrslgpvgfmksaislaedeewkrirsllsptftsgklkemf
    piiaqygdvlvrnlrreaekgkpvtlkdifgaysmdvitgtsfgvnidslnnpqdpfves
    tkkflkfgfldplflsiilfpfltpvfealnvslfpkdtinflsksvnrmkksrlndkqk
    hrldflqlmidsqnsalsdlelaaqsiififagyettssvlsftlyelathpdvqqklqk
    eidavlpnkapptydavvqmeyldmvvnetlrlfpvairlertckkdveingvfipkgsm
    vviptyalhhdpkywtepeefrperfssidpyiytpfgtgprncigmrfalmnmklalir
    vlqnfsfkpcketqiplkldtqgllqpekpivlkvdsr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5veuC (C:)
    malygtrthglfkrlgipgptplpllgnvlsyrqglwkfdtecykkygkmwgtyegqlpv
    laitdpdvirtvlvkecysvftnrrslgpvgfmksaislaedeewkrirsllsptftsgk
    lkemfpiiaqygdvlvrnlrreaekgkpvtlkdifgaysmdvitgtsfgvnidslnnpqd
    pfvestkkflkfgfldplflsiilfpfltpvfealnvslfpkdtinflsksvnrmkksrl
    ndkqkhrldflqlmidsqnsketeshkalsdlelaaqsiififagyettssvlsftlyel
    athpdvqqklqkeidavlpnkapptydavvqmeyldmvvnetlrlfpvairlertckkdv
    eingvfipkgsmvviptyalhhdpkywtepeefrperfskkkdsidpyiytpfgtgprnc
    igmrfalmnmklalirvlqnfsfkpcketqiplkldtqgllqpekpivlkvdsrdghhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5veuC (C:)
    trthglfkrlgipgptplpllgnvlsyrqglwkfdtecykkygkmwgtyegqlpvlaitd
    pdvirtvlvkecysvftnrrslgpvgfmksaislaedeewkrirsllsptftsgklkemf
    piiaqygdvlvrnlrreaekgkpvtlkdifgaysmdvitgtsfgvnidslnnpqdpfves
    tkkflkfgfldplflsiilfpfltpvfealnvslfpkdtinflsksvnrmkksrlndkqk
    hrldflqlmidsqnsketeshkalsdlelaaqsiififagyettssvlsftlyelathpd
    vqqklqkeidavlpnkapptydavvqmeyldmvvnetlrlfpvairlertckkdveingv
    fipkgsmvviptyalhhdpkywtepeefrperfskkkdsidpyiytpfgtgprncigmrf
    almnmklalirvlqnfsfkpcketqiplkldtqgllqpekpivlkvdsr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5veuD (D:)
    malygtrthglfkrlgipgptplpllgnvlsyrqglwkfdtecykkygkmwgtyegqlpv
    laitdpdvirtvlvkecysvftnrrslgpvgfmksaislaedeewkrirsllsptftsgk
    lkemfpiiaqygdvlvrnlrreaekgkpvtlkdifgaysmdvitgtsfgvnidslnnpqd
    pfvestkkflkfgfldplflsiilfpfltpvfealnvslfpkdtinflsksvnrmkksrl
    ndkqkhrldflqlmidsqnsketeshkalsdlelaaqsiififagyettssvlsftlyel
    athpdvqqklqkeidavlpnkapptydavvqmeyldmvvnetlrlfpvairlertckkdv
    eingvfipkgsmvviptyalhhdpkywtepeefrperfskkkdsidpyiytpfgtgprnc
    igmrfalmnmklalirvlqnfsfkpcketqiplkldtqgllqpekpivlkvdsrdghhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5veuD (D:)
    trthglfkrlgipgptplpllgnvlsyrqglwkfdtecykkygkmwgtyegqlpvlaitd
    pdvirtvlvkecysvftnrrslgpvgfmksaislaedeewkrirsllsptftsgklkemf
    piiaqygdvlvrnlrreaekgkpvtlkdifgaysmdvitgtsfgvnidslnnpqdpfves
    tkkflkfgfldplflsiilfpfltpvfealnvslfpkdtinflsksvnrmkksrlndkqk
    hrldflqlmidsqnsalsdlelaaqsiififagyettssvlsftlyelathpdvqqklqk
    eidavlpnkapptydavvqmeyldmvvnetlrlfpvairlertckkdveingvfipkgsm
    vviptyalhhdpkywtepeefrperfsdsidpyiytpfgtgprncigmrfalmnmklali
    rvlqnfsfkpcketqiplkldtqgllqpekpivlkvdsr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5veuE (E:)
    malygtrthglfkrlgipgptplpllgnvlsyrqglwkfdtecykkygkmwgtyegqlpv
    laitdpdvirtvlvkecysvftnrrslgpvgfmksaislaedeewkrirsllsptftsgk
    lkemfpiiaqygdvlvrnlrreaekgkpvtlkdifgaysmdvitgtsfgvnidslnnpqd
    pfvestkkflkfgfldplflsiilfpfltpvfealnvslfpkdtinflsksvnrmkksrl
    ndkqkhrldflqlmidsqnsketeshkalsdlelaaqsiififagyettssvlsftlyel
    athpdvqqklqkeidavlpnkapptydavvqmeyldmvvnetlrlfpvairlertckkdv
    eingvfipkgsmvviptyalhhdpkywtepeefrperfskkkdsidpyiytpfgtgprnc
    igmrfalmnmklalirvlqnfsfkpcketqiplkldtqgllqpekpivlkvdsrdghhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5veuE (E:)
    trthglfkrlgipgptplpllgnvlsyrqglwkfdtecykkygkmwgtyegqlpvlaitd
    pdvirtvlvkecysvftnrrslgpvgfmksaislaedeewkrirsllsptftsgklkemf
    piiaqygdvlvrnlrreaepvtlkdifgaysmdvitgtsfgvnidslnnpqdpfvestkk
    flkfgfldplflsiilfpfltpvfealnvslfpkdtinflsksvnrmkksrlnldflqlm
    idsqalsdlelaaqsiififagyettssvlsftlyelathpdvqqklqkeidavlpnkap
    ptydavvqmeyldmvvnetlrlfpvairlertckkdveingvfipkgsmvviptyalhhd
    pkywtepeefrperfsidpyiytpfgtgprncigmrfalmnmklalirvlqnfsfkpcke
    tqiplkldtqgllqpekpivl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5veuF (F:)
    malygtrthglfkrlgipgptplpllgnvlsyrqglwkfdtecykkygkmwgtyegqlpv
    laitdpdvirtvlvkecysvftnrrslgpvgfmksaislaedeewkrirsllsptftsgk
    lkemfpiiaqygdvlvrnlrreaekgkpvtlkdifgaysmdvitgtsfgvnidslnnpqd
    pfvestkkflkfgfldplflsiilfpfltpvfealnvslfpkdtinflsksvnrmkksrl
    ndkqkhrldflqlmidsqnsketeshkalsdlelaaqsiififagyettssvlsftlyel
    athpdvqqklqkeidavlpnkapptydavvqmeyldmvvnetlrlfpvairlertckkdv
    eingvfipkgsmvviptyalhhdpkywtepeefrperfskkkdsidpyiytpfgtgprnc
    igmrfalmnmklalirvlqnfsfkpcketqiplkldtqgllqpekpivlkvdsrdghhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5veuF (F:)
    thglfkrlgipgptplpllgnvlsyrqglwkfdtecykkygkmwgtyegqlpvlaitdpd
    virtvlvkecysvftnrrslgpvgfmksaislaedeewkrirsllsptftsgklkemfpi
    iaqygdvlvrnlrreaekgkpvtlkdifgaysmdvitgtsfgvnidslnnpqdpfvestk
    kflkfgfldplflsiilfpfltpvfealnvslfpkdtinflsksvnrmkksrlndkqkhr
    ldflqlmidsqnsalsdlelaaqsiififagyettssvlsftlyelathpdvqqklqkei
    davlpnkapptydavvqmeyldmvvnetlrlfpvairlertckkdveingvfipkgsmvv
    iptyalhhdpkywtepeefrperfssidpyiytpfgtgprncigmrfalmnmklalirvl
    qnfsfkpcketqiplkldtqgllqpekpivlkvdsr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5veuG (G:)
    malygtrthglfkrlgipgptplpllgnvlsyrqglwkfdtecykkygkmwgtyegqlpv
    laitdpdvirtvlvkecysvftnrrslgpvgfmksaislaedeewkrirsllsptftsgk
    lkemfpiiaqygdvlvrnlrreaekgkpvtlkdifgaysmdvitgtsfgvnidslnnpqd
    pfvestkkflkfgfldplflsiilfpfltpvfealnvslfpkdtinflsksvnrmkksrl
    ndkqkhrldflqlmidsqnsketeshkalsdlelaaqsiififagyettssvlsftlyel
    athpdvqqklqkeidavlpnkapptydavvqmeyldmvvnetlrlfpvairlertckkdv
    eingvfipkgsmvviptyalhhdpkywtepeefrperfskkkdsidpyiytpfgtgprnc
    igmrfalmnmklalirvlqnfsfkpcketqiplkldtqgllqpekpivlkvdsrdghhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5veuG (G:)
    trthglfkrlgipgptplpllgnvlsyrqglwkfdtecykkygkmwgtyegqlpvlaitd
    pdvirtvlvkecysvftnrrslgpvgfmksaislaedeewkrirsllsptftsgklkemf
    piiaqygdvlvrnlrreaekgkpvtlkdifgaysmdvitgtsfgvnidslnnpqdpfves
    tkkflkfgfldplflsiilfpfltpvfealnvslfpkdtinflsksvnrmkksrlndkrl
    dflqlmidsqnsalsdlelaaqsiififagyettssvlsftlyelathpdvqqklqkeid
    avlpnkapptydavvqmeyldmvvnetlrlfpvairlertckkdveingvfipkgsmvvi
    ptyalhhdpkywtepeefrperfssidpyiytpfgtgprncigmrfalmnmklalirvlq
    nfsfkpcketqiplkldtqgllqpekpivlkvdsr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5veuH (H:)
    malygtrthglfkrlgipgptplpllgnvlsyrqglwkfdtecykkygkmwgtyegqlpv
    laitdpdvirtvlvkecysvftnrrslgpvgfmksaislaedeewkrirsllsptftsgk
    lkemfpiiaqygdvlvrnlrreaekgkpvtlkdifgaysmdvitgtsfgvnidslnnpqd
    pfvestkkflkfgfldplflsiilfpfltpvfealnvslfpkdtinflsksvnrmkksrl
    ndkqkhrldflqlmidsqnsketeshkalsdlelaaqsiififagyettssvlsftlyel
    athpdvqqklqkeidavlpnkapptydavvqmeyldmvvnetlrlfpvairlertckkdv
    eingvfipkgsmvviptyalhhdpkywtepeefrperfskkkdsidpyiytpfgtgprnc
    igmrfalmnmklalirvlqnfsfkpcketqiplkldtqgllqpekpivlkvdsrdghhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5veuH (H:)
    trthglfkrlgipgptplpllgnvlsyrqglwkfdtecykkygkmwgtyegqlpvlaitd
    pdvirtvlvkecysvftnrrslgpvgfmksaislaedeewkrirsllsptftsgklkemf
    piiaqygdvlvrnlrreaekgkpvtlkdifgaysmdvitgtsfgvnidslnnpqdpfves
    tkkflkfgfldplflsiilfpfltpvfealnvslfpkdtinflsksvnrmkksrlndkqk
    hrldflqlmidsqnsalsdlelaaqsiififagyettssvlsftlyelathpdvqqklqk
    eidavlpnkapptydavvqmeyldmvvnetlrlfpvairlertckkdveingvfipkgsm
    vviptyalhhdpkywtepeefrperfsdsidpyiytpfgtgprncigmrfalmnmklali
    rvlqnfsfkpcketqiplkldtqgllqpekpivlkvdsr
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5veuI (I:)
    malygtrthglfkrlgipgptplpllgnvlsyrqglwkfdtecykkygkmwgtyegqlpv
    laitdpdvirtvlvkecysvftnrrslgpvgfmksaislaedeewkrirsllsptftsgk
    lkemfpiiaqygdvlvrnlrreaekgkpvtlkdifgaysmdvitgtsfgvnidslnnpqd
    pfvestkkflkfgfldplflsiilfpfltpvfealnvslfpkdtinflsksvnrmkksrl
    ndkqkhrldflqlmidsqnsketeshkalsdlelaaqsiififagyettssvlsftlyel
    athpdvqqklqkeidavlpnkapptydavvqmeyldmvvnetlrlfpvairlertckkdv
    eingvfipkgsmvviptyalhhdpkywtepeefrperfskkkdsidpyiytpfgtgprnc
    igmrfalmnmklalirvlqnfsfkpcketqiplkldtqgllqpekpivlkvdsrdghhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5veuI (I:)
    trthglfkrlgipgptplpllgnvlsyrqglwkfdtecykkygkmwgtyegqlpvlaitd
    pdvirtvlvkecysvftnrrslgpvgfmksaislaedeewkrirsllsptftsgklkemf
    piiaqygdvlvrnlrreaekgkpvtlkdifgaysmdvitgtsfgvnidslnnpqdpfves
    tkkflkfgfldplflsiilfpfltpvfealnvslfpkdtinflsksvnrmkksrlndkqk
    hrldflqlmidsqnsketeshkalsdlelaaqsiififagyettssvlsftlyelathpd
    vqqklqkeidavlpnkapptydavvqmeyldmvvnetlrlfpvairlertckkdveingv
    fipkgsmvviptyalhhdpkywtepeefrperfsidpyiytpfgtgprncigmrfalmnm
    klalirvlqnfsfkpcketqiplkldtqgllqpekpivlkvdsr
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5veuJ (J:)
    malygtrthglfkrlgipgptplpllgnvlsyrqglwkfdtecykkygkmwgtyegqlpv
    laitdpdvirtvlvkecysvftnrrslgpvgfmksaislaedeewkrirsllsptftsgk
    lkemfpiiaqygdvlvrnlrreaekgkpvtlkdifgaysmdvitgtsfgvnidslnnpqd
    pfvestkkflkfgfldplflsiilfpfltpvfealnvslfpkdtinflsksvnrmkksrl
    ndkqkhrldflqlmidsqnsketeshkalsdlelaaqsiififagyettssvlsftlyel
    athpdvqqklqkeidavlpnkapptydavvqmeyldmvvnetlrlfpvairlertckkdv
    eingvfipkgsmvviptyalhhdpkywtepeefrperfskkkdsidpyiytpfgtgprnc
    igmrfalmnmklalirvlqnfsfkpcketqiplkldtqgllqpekpivlkvdsrdghhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5veuJ (J:)
    trthglfkrlgipgptplpllgnvlsyrqglwkfdtecykkygkmwgtyegqlpvlaitd
    pdvirtvlvkecysvftnrrslgpvgfmksaislaedeewkrirsllsptftsgklkemf
    piiaqygdvlvrnlrreaekgkpvtlkdifgaysmdvitgtsfgvnidslnnpqdpfves
    tkkflkfgfldplflsiilfpfltpvfealnvslfpkdtinflsksvnrmkksrlndkqk
    hrldflqlmidsqnsalsdlelaaqsiififagyettssvlsftlyelathpdvqqklqk
    eidavlpnkapptydavvqmeyldmvvnetlrlfpvairlertckkdveingvfipkgsm
    vviptyalhhdpkywtepeefrperfssidpyiytpfgtgprncigmrfalmnmklalir
    vlqnfsfkpcketqiplkldtqgllqpekpivlkvdsr
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5veuK (K:)
    malygtrthglfkrlgipgptplpllgnvlsyrqglwkfdtecykkygkmwgtyegqlpv
    laitdpdvirtvlvkecysvftnrrslgpvgfmksaislaedeewkrirsllsptftsgk
    lkemfpiiaqygdvlvrnlrreaekgkpvtlkdifgaysmdvitgtsfgvnidslnnpqd
    pfvestkkflkfgfldplflsiilfpfltpvfealnvslfpkdtinflsksvnrmkksrl
    ndkqkhrldflqlmidsqnsketeshkalsdlelaaqsiififagyettssvlsftlyel
    athpdvqqklqkeidavlpnkapptydavvqmeyldmvvnetlrlfpvairlertckkdv
    eingvfipkgsmvviptyalhhdpkywtepeefrperfskkkdsidpyiytpfgtgprnc
    igmrfalmnmklalirvlqnfsfkpcketqiplkldtqgllqpekpivlkvdsrdghhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5veuK (K:)
    trthglfkrlgipgptplpllgnvlsyrqglwkfdtecykkygkmwgtyegqlpvlaitd
    pdvirtvlvkecysvftnrrslgpvgfmksaislaedeewkrirsllsptftsgklkemf
    piiaqygdvlvrnlrreaekgkpvtlkdifgaysmdvitgtsfgvnidslnnpqdpfves
    tkkflkfgfldplflsiilfpfltpvfealnvslfpkdtinflsksvnrmkksrlndkqk
    hrldflqlmidsqnalsdlelaaqsiififagyettssvlsftlyelathpdvqqklqke
    idavlpnkapptydavvqmeyldmvvnetlrlfpvairlertckkdveingvfipkgsmv
    viptyalhhdpkywtepeefrperfsdsidpyiytpfgtgprncigmrfalmnmklalir
    vlqnfsfkpcketqiplkldtqgllqpekpivlkvdsr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5veuL (L:)
    malygtrthglfkrlgipgptplpllgnvlsyrqglwkfdtecykkygkmwgtyegqlpv
    laitdpdvirtvlvkecysvftnrrslgpvgfmksaislaedeewkrirsllsptftsgk
    lkemfpiiaqygdvlvrnlrreaekgkpvtlkdifgaysmdvitgtsfgvnidslnnpqd
    pfvestkkflkfgfldplflsiilfpfltpvfealnvslfpkdtinflsksvnrmkksrl
    ndkqkhrldflqlmidsqnsketeshkalsdlelaaqsiififagyettssvlsftlyel
    athpdvqqklqkeidavlpnkapptydavvqmeyldmvvnetlrlfpvairlertckkdv
    eingvfipkgsmvviptyalhhdpkywtepeefrperfskkkdsidpyiytpfgtgprnc
    igmrfalmnmklalirvlqnfsfkpcketqiplkldtqgllqpekpivlkvdsrdghhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5veuL (L:)
    trthglfkrlgipgptplpllgnvlsyrqglwkfdtecykkygkmwgtyegqlpvlaitd
    pdvirtvlvkecysvftnrrslgpvgfmksaislaedeewkrirsllsptftsgklkemf
    piiaqygdvlvrnlrreaekgkpvtlkdifgaysmdvitgtsfgvnidslnnpqdpfves
    tkkflkfgfldplflsiilfpfltpvfealnvslfpkdtinflsksvnrmkksrlnflql
    midsqnsalsdlelaaqsiififagyettssvlsftlyelathpdvqqklqkeidavlpn
    kapptydavvqmeyldmvvnetlrlfpvairlertckkdveingvfipkgsmvviptyal
    hhdpkywtepeefrperfsidpyiytpfgtgprncigmrfalmnmklalirvlqnfsfkp
    cketqiplkldtqgllqpekpivlkvds