PDB entry 5vec

View 5vec on RCSB PDB site
Description: Crystal Structure of the R515L missense variant of human PGM1
Class: isomerase
Keywords: phosphoglucomutase-1, PGM1, isomerase, phosphoryl transfer
Deposited on 2017-04-04, released 2018-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoglucomutase-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PGM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36871 (23-584)
      • expression tag (21-22)
      • engineered mutation (537)
    Domains in SCOPe 2.07: d5veca1, d5veca2, d5veca3, d5veca4, d5veca5
  • Chain 'B':
    Compound: Phosphoglucomutase-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PGM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36871 (23-584)
      • expression tag (21-22)
      • engineered mutation (537)
    Domains in SCOPe 2.07: d5vecb1, d5vecb2, d5vecb3, d5vecb4, d5vecb5
  • Heterogens: SO4, MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vecA (A:)
    mhhhhhhssgvdlgtenlyfqsnmvkivtvktqayqdqkpgtsglrkrvkvfqssanyae
    nfiqsiistvepaqrqeatlvvggdgrfymkeaiqliariaaangigrlvigqngilstp
    avsciirkikaiggiiltashnpggpngdfgikfnisnggpapeaitdkifqisktieey
    avcpdlkvdlgvlgkqqfdlenkfkpftveivdsveayatmlrsifdfsalkellsgpnr
    lkiridamhgvvgpyvkkilceelgapansavncvpledfgghhpdpnltyaadlvetmk
    sgehdfgaafdgdgdrnmilgkhgffvnpsdsvaviaanifsipyfqqtgvrgfarsmpt
    sgaldrvasatkialyetptgwkffgnlmdasklslcgeesfgtgsdhirekdglwavla
    wlsilatrkqsvedilkdhwqkygrnfftrydyeeveaegankmmkdlealmfdrsfvgk
    qfsandkvytvekadnfeysdpvdgsisrnqglrliftdgsrivfrlsgtgsagatilly
    idsyekdvakinqdpqvmlaplisialkvsqlqertgrtaptvit
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vecA (A:)
    snmvkivtvktqayqdqkpgtsglrkrvkvfqssanyaenfiqsiistvepaqrqeatlv
    vggdgrfymkeaiqliariaaangigrlvigqngilstpavsciirkikaiggiiltash
    npggpngdfgikfnisnggpapeaitdkifqisktieeyavcpdlkvdlgvlgkqqfdle
    nkfkpftveivdsveayatmlrsifdfsalkellsgpnrlkiridamhgvvgpyvkkilc
    eelgapansavncvpledfgghhpdpnltyaadlvetmksgehdfgaafdgdgdrnmilg
    khgffvnpsdsvaviaanifsipyfqqtgvrgfarsmptsgaldrvasatkialyetptg
    wkffgnlmdasklslcgeesfgtgsdhirekdglwavlawlsilatrkqsvedilkdhwq
    kygrnfftrydyeeveaegankmmkdlealmfdrsfvgkqfsandkvytvekadnfeysd
    pvdgsisrnqglrliftdgsrivfrlsgtgsagatillyidsyekdvakinqdpqvmlap
    lisialkvsqlqertgrtaptvit
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5vecB (B:)
    mhhhhhhssgvdlgtenlyfqsnmvkivtvktqayqdqkpgtsglrkrvkvfqssanyae
    nfiqsiistvepaqrqeatlvvggdgrfymkeaiqliariaaangigrlvigqngilstp
    avsciirkikaiggiiltashnpggpngdfgikfnisnggpapeaitdkifqisktieey
    avcpdlkvdlgvlgkqqfdlenkfkpftveivdsveayatmlrsifdfsalkellsgpnr
    lkiridamhgvvgpyvkkilceelgapansavncvpledfgghhpdpnltyaadlvetmk
    sgehdfgaafdgdgdrnmilgkhgffvnpsdsvaviaanifsipyfqqtgvrgfarsmpt
    sgaldrvasatkialyetptgwkffgnlmdasklslcgeesfgtgsdhirekdglwavla
    wlsilatrkqsvedilkdhwqkygrnfftrydyeeveaegankmmkdlealmfdrsfvgk
    qfsandkvytvekadnfeysdpvdgsisrnqglrliftdgsrivfrlsgtgsagatilly
    idsyekdvakinqdpqvmlaplisialkvsqlqertgrtaptvit
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vecB (B:)
    snmvkivtvktqayqdqkpgtsglrkrvkvfqssanyaenfiqsiistvepaqrqeatlv
    vggdgrfymkeaiqliariaaangigrlvigqngilstpavsciirkikaiggiiltash
    npggpngdfgikfnisnggpapeaitdkifqisktieeyavcpdlkvdlgvlgkqqfdle
    nkfkpftveivdsveayatmlrsifdfsalkellsgpnrlkiridamhgvvgpyvkkilc
    eelgapansavncvpledfgghhpdpnltyaadlvetmksgehdfgaafdgdgdrnmilg
    khgffvnpsdsvaviaanifsipyfqqtgvrgfarsmptsgaldrvasatkialyetptg
    wkffgnlmdasklslcgeesfgtgsdhirekdglwavlawlsilatrkqsvedilkdhwq
    kygrnfftrydyeeveaegankmmkdlealmfdrsfvgkqfsandkvytvekadnfeysd
    pvdgsisrnqglrliftdgsrivfrlsgtgsagatillyidsyekdvakinqdpqvmlap
    lisialkvsqlqertgrtaptvit