PDB entry 5vcg

View 5vcg on RCSB PDB site
Description: Crystal structure of the cysteine depleted CYP3A4 bound to bromoergocryptine
Class: oxidoreductase/substrate
Keywords: cytochrome P450, CYP3A4, monooxygenase, cysteine mutation, bromoergocryprine, OXIDOREDUCTASE-SUBSTRATE complex
Deposited on 2017-03-31, released 2017-05-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450 3a4
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP3A4, CYP3A3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08684
      • engineered mutation (37)
      • engineered mutation (43)
      • engineered mutation (77)
      • engineered mutation (218)
      • engineered mutation (356)
      • engineered mutation (447)
    Domains in SCOPe 2.07: d5vcga_
  • Heterogens: HEM, 08Y, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vcgA (A:)
    maylygthshglfkklgipgptplpflgnilsyhkgfamfdmemhkkygkvwgfydgqqp
    vlaitdpdmiktvlvkeaysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsg
    klkemvpiiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpq
    dpfventkkllrfdfldpfflsitvfpflipilevlnitvfprevtnflrksvkrmkesr
    ledtqkhrvdflqlmidsqnsketeshkalsdlelvaqsiififagyettssvlsfimye
    lathpdvqqklqeeidavlpnkapptydtvlqmeyldmvvnetlrlfpiamrlervakkd
    veingmfipkgvvvmipsyalhrdpkywtepekflperfskknkdnidpyiytpfgsgpr
    ncigmrfalmnmklalirvlqnfsfkpsketqiplklslggllqpekpvvlkvesrdgtv
    sgahhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vcgA (A:)
    hshglfkklgipgptplpflgnilsyhkgfamfdmemhkkygkvwgfydgqqpvlaitdp
    dmiktvlvkeaysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgklkemvp
    iiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpqdpfvent
    kkllrfdfldpfflsitvfpflipilevlnitvfprevtnflrksvkrmkesrledhrvd
    flqlmidsqnskalsdlelvaqsiififagyettssvlsfimyelathpdvqqklqeeid
    avlpnkapptydtvlqmeyldmvvnetlrlfpiamrlervakkdveingmfipkgvvvmi
    psyalhrdpkywtepekflperfskknkdnidpyiytpfgsgprncigmrfalmnmklal
    irvlqnfsfkpsketqiplklslggllqpekpvvlkvesrd