PDB entry 5vc1

View 5vc1 on RCSB PDB site
Description: Crystal structure of L-selectin lectin/EGF domains
Class: cell adhesion
Keywords: L-selectin; glycoprotein, cell adhesion
Deposited on 2017-03-30, released 2017-06-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-12, with a file datestamp of 2017-07-07.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-selectin
    Species: Homo sapiens [TaxId:9606]
    Gene: SELL, LNHR, LYAM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14151 (0-End)
      • engineered mutation (21)
      • engineered mutation (138)
    Domains in SCOPe 2.07: d5vc1a1, d5vc1a2
  • Heterogens: NAG, MAN, BMA, PG4, PEG, GOL, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vc1A (A:)
    wtyhysekpmnwqrarrfcrdqytdlvaiqnkaeieylektlpfsrsyywigirkiggiw
    twvgtnkslteeaenwgdgepnnkknkedcveiyikrnkdagkwnddachklkaalcyta
    scqpwscsghgecveiinqytcncdvgyygpqcqfvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vc1A (A:)
    wtyhysekpmnwqrarrfcrdqytdlvaiqnkaeieylektlpfsrsyywigirkiggiw
    twvgtnkslteeaenwgdgepnnkknkedcveiyikrnkdagkwnddachklkaalcyta
    scqpwscsghgecveiinqytcncdvgyygpqc