PDB entry 5vbz

View 5vbz on RCSB PDB site
Description: Crystal Structure of Small Molecule Disulfide 2C07 Bound to H-Ras M72C GppNHp
Class: hydrolase
Keywords: GTPase, Inhibitor, GDP, HYDROLASE
Deposited on 2017-03-30, released 2017-10-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gtpase hras
    Species: Homo sapiens [TaxId:9606]
    Gene: HRAS, HRAS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01112 (5-170)
      • engineered mutation (76)
    Domains in SCOPe 2.07: d5vbza_
  • Chain 'B':
    Compound: gtpase hras
    Species: Homo sapiens [TaxId:9606]
    Gene: HRAS, HRAS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01112 (5-170)
      • engineered mutation (76)
    Domains in SCOPe 2.07: d5vbzb_
  • Chain 'C':
    Compound: gtpase hras
    Species: Homo sapiens [TaxId:9606]
    Gene: HRAS, HRAS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01112 (5-170)
      • engineered mutation (76)
    Domains in SCOPe 2.07: d5vbzc_
  • Heterogens: GNP, MG, 92V, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vbzA (A:)
    gamgsmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldi
    ldtagqeeysamrdqycrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvg
    nkcdlaartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vbzA (A:)
    mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
    crtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdlaartvesrqaq
    dlarsygipyietsaktrqgvedafytlvreirqh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5vbzB (B:)
    gamgsmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldi
    ldtagqeeysamrdqycrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvg
    nkcdlaartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vbzB (B:)
    mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
    eysamrdqycrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdlaa
    rtvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5vbzC (C:)
    gamgsmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldi
    ldtagqeeysamrdqycrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvg
    nkcdlaartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vbzC (C:)
    mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
    eysamrdqycrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdlaa
    rtvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh