PDB entry 5vbm

View 5vbm on RCSB PDB site
Description: Crystal Structure of Small Molecule Disulfide 2C07 Bound to K-Ras Cys Light M72C GDP
Class: hydrolase
Keywords: GTPase, Inhibitor, GDP, HYDROLASE
Deposited on 2017-03-29, released 2017-10-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (1-169)
      • expression tag (0)
      • engineered mutation (51)
      • engineered mutation (72)
      • engineered mutation (80)
      • engineered mutation (118)
    Domains in SCOPe 2.06: d5vbma1, d5vbma2
  • Heterogens: MG, GDP, 92V, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vbmA (A:)
    gmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetslldildta
    gqeeysamrdqycrtgegfllvfainntksfedihhyreqikrvkdsedvpmvlvgnksd
    lpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vbmA (A:)
    gmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetslldildta
    geysamrdqycrtgegfllvfainntksfedihhyreqikrvkdsedvpmvlvgnksdlp
    srtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek