PDB entry 5vbi

View 5vbi on RCSB PDB site
Description: Crystal Structure of the R515W missense variant of human PGM1
Class: isomerase
Keywords: phosphoglucomutase-1, PGM1, isomerase, phosphoryl transfer
Deposited on 2017-03-29, released 2018-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-20, with a file datestamp of 2018-06-15.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoglucomutase-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PGM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36871 (23-584)
      • expression tag (22)
      • engineered mutation (537)
    Domains in SCOPe 2.07: d5vbia1, d5vbia2, d5vbia3, d5vbia4, d5vbia5
  • Chain 'B':
    Compound: Phosphoglucomutase-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PGM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36871 (23-584)
      • engineered mutation (537)
    Domains in SCOPe 2.07: d5vbib1, d5vbib2, d5vbib3, d5vbib4
  • Heterogens: SO4, MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vbiA (A:)
    mhhhhhhssgvdlgtenlyfqsnmvkivtvktqayqdqkpgtsglrkrvkvfqssanyae
    nfiqsiistvepaqrqeatlvvggdgrfymkeaiqliariaaangigrlvigqngilstp
    avsciirkikaiggiiltashnpggpngdfgikfnisnggpapeaitdkifqisktieey
    avcpdlkvdlgvlgkqqfdlenkfkpftveivdsveayatmlrsifdfsalkellsgpnr
    lkiridamhgvvgpyvkkilceelgapansavncvpledfgghhpdpnltyaadlvetmk
    sgehdfgaafdgdgdrnmilgkhgffvnpsdsvaviaanifsipyfqqtgvrgfarsmpt
    sgaldrvasatkialyetptgwkffgnlmdasklslcgeesfgtgsdhirekdglwavla
    wlsilatrkqsvedilkdhwqkygrnfftrydyeeveaegankmmkdlealmfdrsfvgk
    qfsandkvytvekadnfeysdpvdgsisrnqglrliftdgsrivfrlsgtgsagatiwly
    idsyekdvakinqdpqvmlaplisialkvsqlqertgrtaptvit
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vbiA (A:)
    nmvkivtvktqayqdqkpgtsglrkrvkvfqssanyaenfiqsiistvepaqrqeatlvv
    ggdgrfymkeaiqliariaaangigrlvigqngilstpavsciirkikaiggiiltashn
    pggpngdfgikfnisnggpapeaitdkifqisktieeyavcpdlkvdlgvlgkqqfdlen
    kfkpftveivdsveayatmlrsifdfsalkellsgpnrlkiridamhgvvgpyvkkilce
    elgapansavncvpledfgghhpdpnltyaadlvetmksgehdfgaafdgdgdrnmilgk
    hgffvnpsdsvaviaanifsipyfqqtgvrgfarsmptsgaldrvasatkialyetptgw
    kffgnlmdasklslcgeesfgtgsdhirekdglwavlawlsilatrkqsvedilkdhwqk
    ygrnfftrydyeeveaegankmmkdlealmfdrsfvgkqfsandkvytvekadnfeysdp
    vdgsisrnqglrliftdgsrivfrlsgtgsagatiwlyidsyekdvakinqdpqvmlapl
    isialkvsqlqertgrtaptvit
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5vbiB (B:)
    mhhhhhhssgvdlgtenlyfqsnmvkivtvktqayqdqkpgtsglrkrvkvfqssanyae
    nfiqsiistvepaqrqeatlvvggdgrfymkeaiqliariaaangigrlvigqngilstp
    avsciirkikaiggiiltashnpggpngdfgikfnisnggpapeaitdkifqisktieey
    avcpdlkvdlgvlgkqqfdlenkfkpftveivdsveayatmlrsifdfsalkellsgpnr
    lkiridamhgvvgpyvkkilceelgapansavncvpledfgghhpdpnltyaadlvetmk
    sgehdfgaafdgdgdrnmilgkhgffvnpsdsvaviaanifsipyfqqtgvrgfarsmpt
    sgaldrvasatkialyetptgwkffgnlmdasklslcgeesfgtgsdhirekdglwavla
    wlsilatrkqsvedilkdhwqkygrnfftrydyeeveaegankmmkdlealmfdrsfvgk
    qfsandkvytvekadnfeysdpvdgsisrnqglrliftdgsrivfrlsgtgsagatiwly
    idsyekdvakinqdpqvmlaplisialkvsqlqertgrtaptvit
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vbiB (B:)
    mvkivtvktqayqdqkpgtsglrkrvkvfqssanyaenfiqsiistvepaqrqeatlvvg
    gdgrfymkeaiqliariaaangigrlvigqngilstpavsciirkikaiggiiltashnp
    ggpngdfgikfnisnggpapeaitdkifqisktieeyavcpdlkvdlgvlgkqqfdlenk
    fkpftveivdsveayatmlrsifdfsalkellsgpnrlkiridamhgvvgpyvkkilcee
    lgapansavncvpledfgghhpdpnltyaadlvetmksgehdfgaafdgdgdrnmilgkh
    gffvnpsdsvaviaanifsipyfqqtgvrgfarsmptsgaldrvasatkialyetptgwk
    ffgnlmdasklslcgeesfgtgsdhirekdglwavlawlsilatrkqsvedilkdhwqky
    grnfftrydyeeveaegankmmkdlealmfdrsfvgkqfsandkvytvekadnfeysdpv
    dgsisrnqglrliftdgsrivfrlsgtgsagatiwlyidsyekdvakinqdpqvmlapli
    sialkvsqlqertgrtaptvit