PDB entry 5vbf

View 5vbf on RCSB PDB site
Description: Crystal structure of succinate semialdehyde dehydrogenase from Burkholderia vietnamiensis
Class: oxidoreductase
Keywords: SSGCID, succinate semialdehyde dehydrogenase, Burkholderia vietnamiensis, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, OXIDOREDUCTASE
Deposited on 2017-03-29, released 2017-04-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-12, with a file datestamp of 2017-04-07.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAD-dependent succinate-semialdehyde dehydrogenase
    Species: Burkholderia vietnamiensis [TaxId:60552]
    Gene: WK24_04400
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vbfa_
  • Chain 'B':
    Compound: NAD-dependent succinate-semialdehyde dehydrogenase
    Species: Burkholderia vietnamiensis [TaxId:60552]
    Gene: WK24_04400
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vbfb_
  • Chain 'C':
    Compound: NAD-dependent succinate-semialdehyde dehydrogenase
    Species: Burkholderia vietnamiensis [TaxId:60552]
    Gene: WK24_04400
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vbfc_
  • Chain 'D':
    Compound: NAD-dependent succinate-semialdehyde dehydrogenase
    Species: Burkholderia vietnamiensis [TaxId:60552]
    Gene: WK24_04400
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vbfd_
  • Chain 'E':
    Compound: NAD-dependent succinate-semialdehyde dehydrogenase
    Species: Burkholderia vietnamiensis [TaxId:60552]
    Gene: WK24_04400
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vbfe_
  • Chain 'F':
    Compound: NAD-dependent succinate-semialdehyde dehydrogenase
    Species: Burkholderia vietnamiensis [TaxId:60552]
    Gene: WK24_04400
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vbff_
  • Chain 'G':
    Compound: NAD-dependent succinate-semialdehyde dehydrogenase
    Species: Burkholderia vietnamiensis [TaxId:60552]
    Gene: WK24_04400
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vbfg_
  • Chain 'H':
    Compound: NAD-dependent succinate-semialdehyde dehydrogenase
    Species: Burkholderia vietnamiensis [TaxId:60552]
    Gene: WK24_04400
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vbfh_
  • Heterogens: MES, GOL, FMT, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5vbfA (A:)
    rhdyaplrlyidgrfhdadgrrtqpvvdpgttrvlgelphatahdidaavqaahrafvtw
    rhesplvrsdllrraaalareraetigrhitmdqgkplreaiaevvsaaeqlewhaeegr
    rtygrvvparspdvmqtvlrepigvcaafspwnfpfsqamhkiaaalasgctlvlkgpee
    spsaivalaqlfhdaglppgclnivwgvpgdvskqlieapqvrkisftgsvpvgkqlaal
    aaslmkrmtmelgghapvlvcadadveraaamlaaykfrnagqvcvsptrffvqraafdr
    fvcayldavgtirvgygldagvtmgplaharrvdeidafvadatakgaqiatggmrlpgp
    ghyfaptvvlgptrdtrlmndepfgpivgivpfddlddalaeanrlpfglasyafttsar
    nahrisraleagmvninhfgmgpaeipfggvkdsgfgseggmeafdgylvtkfvtqmn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5vbfB (B:)
    rhdyaplrlyidgrfhdadgrrtqpvvdpgttrvlgelphatahdidaavqaahrafvtw
    rhesplvrsdllrraaalareraetigrhitmdqgkplreaiaevvsaaeqlewhaeegr
    rtygrvvparspdvmqtvlrepigvcaafspwnfpfsqamhkiaaalasgctlvlkgpee
    spsaivalaqlfhdaglppgclnivwgvpgdvskqlieapqvrkisftgsvpvgkqlaal
    aaslmkrmtmelgghapvlvcadadveraaamlaaykfrnagqvcvsptrffvqraafdr
    fvcayldavgtirvgygldagvtmgplaharrvdeidafvadatakgaqiatggmrlpgp
    ghyfaptvvlgptrdtrlmndepfgpivgivpfddlddalaeanrlpfglasyafttsar
    nahrisraleagmvninhfgmgpaeipfggvkdsgfgseggmeafdgylvtkfvtqmn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5vbfC (C:)
    rhdyaplrlyidgrfhdadgrrtqpvvdpgttrvlgelphatahdidaavqaahrafvtw
    rhesplvrsdllrraaalareraetigrhitmdqgkplreaiaevvsaaeqlewhaeegr
    rtygrvvparspdvmqtvlrepigvcaafspwnfpfsqamhkiaaalasgctlvlkgpee
    spsaivalaqlfhdaglppgclnivwgvpgdvskqlieapqvrkisftgsvpvgkqlaal
    aaslmkrmtmelgghapvlvcadadveraaamlaaykfrnagqvcvsptrffvqraafdr
    fvcayldavgtirvgygldagvtmgplaharrvdeidafvadatakgaqiatggmrlpgp
    ghyfaptvvlgptrdtrlmndepfgpivgivpfddlddalaeanrlpfglasyafttsar
    nahrisraleagmvninhfgmgpaeipfggvkdsgfgseggmeafdgylvtkfvtqmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vbfC (C:)
    dyaplrlyidgrfhdadgrrtqpvvdpgttrvlgelphatahdidaavqaahrafvtwrh
    esplvrsdllrraaalareraetigrhitmdqgkplreaiaevvsaaeqlewhaeegrrt
    ygrvvparspdvmqtvlrepigvcaafspwnfpfsqamhkiaaalasgctlvlkgpeesp
    saivalaqlfhdaglppgclnivwgvpgdvskqlieapqvrkisftgsvpvgkqlaalaa
    slmkrmtmelgghapvlvcadadveraaamlaaykfrnagqvcvsptrffvqraafdrfv
    cayldavgtirvgygldagvtmgplaharrvdeidafvadatakgaqiatggmrlpgpgh
    yfaptvvlgptrdtrlmndepfgpivgivpfddlddalaeanrlpfglasyafttsarna
    hrisraleagmvninhfgmgpaeipfggvkdsgfgseggmeafdgylvtkfvtqmn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5vbfD (D:)
    rhdyaplrlyidgrfhdadgrrtqpvvdpgttrvlgelphatahdidaavqaahrafvtw
    rhesplvrsdllrraaalareraetigrhitmdqgkplreaiaevvsaaeqlewhaeegr
    rtygrvvparspdvmqtvlrepigvcaafspwnfpfsqamhkiaaalasgctlvlkgpee
    spsaivalaqlfhdaglppgclnivwgvpgdvskqlieapqvrkisftgsvpvgkqlaal
    aaslmkrmtmelgghapvlvcadadveraaamlaaykfrnagqvcvsptrffvqraafdr
    fvcayldavgtirvgygldagvtmgplaharrvdeidafvadatakgaqiatggmrlpgp
    ghyfaptvvlgptrdtrlmndepfgpivgivpfddlddalaeanrlpfglasyafttsar
    nahrisraleagmvninhfgmgpaeipfggvkdsgfgseggmeafdgylvtkfvtqmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vbfD (D:)
    hdyaplrlyidgrfhdadgrrtqpvvdpgttrvlgelphatahdidaavqaahrafvtwr
    hesplvrsdllrraaalareraetigrhitmdqgkplreaiaevvsaaeqlewhaeegrr
    tygrvvparspdvmqtvlrepigvcaafspwnfpfsqamhkiaaalasgctlvlkgpees
    psaivalaqlfhdaglppgclnivwgvpgdvskqlieapqvrkisftgsvpvgkqlaala
    aslmkrmtmelgghapvlvcadadveraaamlaaykfrnagqvcvsptrffvqraafdrf
    vcayldavgtirvgygldagvtmgplaharrvdeidafvadatakgaqiatggmrlpgpg
    hyfaptvvlgptrdtrlmndepfgpivgivpfddlddalaeanrlpfglasyafttsarn
    ahrisraleagmvninhfgmgpaeipfggvkdsgfgseggmeafdgylvtkfvtqmn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5vbfE (E:)
    rhdyaplrlyidgrfhdadgrrtqpvvdpgttrvlgelphatahdidaavqaahrafvtw
    rhesplvrsdllrraaalareraetigrhitmdqgkplreaiaevvsaaeqlewhaeegr
    rtygrvvparspdvmqtvlrepigvcaafspwnfpfsqamhkiaaalasgctlvlkgpee
    spsaivalaqlfhdaglppgclnivwgvpgdvskqlieapqvrkisftgsvpvgkqlaal
    aaslmkrmtmelgghapvlvcadadveraaamlaaykfrnagqvcvsptrffvqraafdr
    fvcayldavgtirvgygldagvtmgplaharrvdeidafvadatakgaqiatggmrlpgp
    ghyfaptvvlgptrdtrlmndepfgpivgivpfddlddalaeanrlpfglasyafttsar
    nahrisraleagmvninhfgmgpaeipfggvkdsgfgseggmeafdgylvtkfvtqmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vbfE (E:)
    dyaplrlyidgrfhdadgrrtqpvvdpgttrvlgelphatahdidaavqaahrafvtwrh
    esplvrsdllrraaalareraetigrhitmdqgkplreaiaevvsaaeqlewhaeegrrt
    ygrvvparspdvmqtvlrepigvcaafspwnfpfsqamhkiaaalasgctlvlkgpeesp
    saivalaqlfhdaglppgclnivwgvpgdvskqlieapqvrkisftgsvpvgkqlaalaa
    slmkrmtmelgghapvlvcadadveraaamlaaykfrnagqvcvsptrffvqraafdrfv
    cayldavgtirvgygldagvtmgplaharrvdeidafvadatakgaqiatggmrlpgpgh
    yfaptvvlgptrdtrlmndepfgpivgivpfddlddalaeanrlpfglasyafttsarna
    hrisraleagmvninhfgmgpaeipfggvkdsgfgseggmeafdgylvtkfvtqmn
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5vbfF (F:)
    rhdyaplrlyidgrfhdadgrrtqpvvdpgttrvlgelphatahdidaavqaahrafvtw
    rhesplvrsdllrraaalareraetigrhitmdqgkplreaiaevvsaaeqlewhaeegr
    rtygrvvparspdvmqtvlrepigvcaafspwnfpfsqamhkiaaalasgctlvlkgpee
    spsaivalaqlfhdaglppgclnivwgvpgdvskqlieapqvrkisftgsvpvgkqlaal
    aaslmkrmtmelgghapvlvcadadveraaamlaaykfrnagqvcvsptrffvqraafdr
    fvcayldavgtirvgygldagvtmgplaharrvdeidafvadatakgaqiatggmrlpgp
    ghyfaptvvlgptrdtrlmndepfgpivgivpfddlddalaeanrlpfglasyafttsar
    nahrisraleagmvninhfgmgpaeipfggvkdsgfgseggmeafdgylvtkfvtqmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vbfF (F:)
    dyaplrlyidgrfhdadgrrtqpvvdpgttrvlgelphatahdidaavqaahrafvtwrh
    esplvrsdllrraaalareraetigrhitmdqgkplreaiaevvsaaeqlewhaeegrrt
    ygrvvparspdvmqtvlrepigvcaafspwnfpfsqamhkiaaalasgctlvlkgpeesp
    saivalaqlfhdaglppgclnivwgvpgdvskqlieapqvrkisftgsvpvgkqlaalaa
    slmkrmtmelgghapvlvcadadveraaamlaaykfrnagqvcvsptrffvqraafdrfv
    cayldavgtirvgygldagvtmgplaharrvdeidafvadatakgaqiatggmrlpgpgh
    yfaptvvlgptrdtrlmndepfgpivgivpfddlddalaeanrlpfglasyafttsarna
    hrisraleagmvninhfgmgpaeipfggvkdsgfgseggmeafdgylvtkfvtqmn
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5vbfG (G:)
    rhdyaplrlyidgrfhdadgrrtqpvvdpgttrvlgelphatahdidaavqaahrafvtw
    rhesplvrsdllrraaalareraetigrhitmdqgkplreaiaevvsaaeqlewhaeegr
    rtygrvvparspdvmqtvlrepigvcaafspwnfpfsqamhkiaaalasgctlvlkgpee
    spsaivalaqlfhdaglppgclnivwgvpgdvskqlieapqvrkisftgsvpvgkqlaal
    aaslmkrmtmelgghapvlvcadadveraaamlaaykfrnagqvcvsptrffvqraafdr
    fvcayldavgtirvgygldagvtmgplaharrvdeidafvadatakgaqiatggmrlpgp
    ghyfaptvvlgptrdtrlmndepfgpivgivpfddlddalaeanrlpfglasyafttsar
    nahrisraleagmvninhfgmgpaeipfggvkdsgfgseggmeafdgylvtkfvtqmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vbfG (G:)
    hdyaplrlyidgrfhdadgrrtqpvvdpgttrvlgelphatahdidaavqaahrafvtwr
    hesplvrsdllrraaalareraetigrhitmdqgkplreaiaevvsaaeqlewhaeegrr
    tygrvvparspdvmqtvlrepigvcaafspwnfpfsqamhkiaaalasgctlvlkgpees
    psaivalaqlfhdaglppgclnivwgvpgdvskqlieapqvrkisftgsvpvgkqlaala
    aslmkrmtmelgghapvlvcadadveraaamlaaykfrnagqvcvsptrffvqraafdrf
    vcayldavgtirvgygldagvtmgplaharrvdeidafvadatakgaqiatggmrlpgpg
    hyfaptvvlgptrdtrlmndepfgpivgivpfddlddalaeanrlpfglasyafttsarn
    ahrisraleagmvninhfgmgpaeipfggvkdsgfgseggmeafdgylvtkfvtqmn
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5vbfH (H:)
    rhdyaplrlyidgrfhdadgrrtqpvvdpgttrvlgelphatahdidaavqaahrafvtw
    rhesplvrsdllrraaalareraetigrhitmdqgkplreaiaevvsaaeqlewhaeegr
    rtygrvvparspdvmqtvlrepigvcaafspwnfpfsqamhkiaaalasgctlvlkgpee
    spsaivalaqlfhdaglppgclnivwgvpgdvskqlieapqvrkisftgsvpvgkqlaal
    aaslmkrmtmelgghapvlvcadadveraaamlaaykfrnagqvcvsptrffvqraafdr
    fvcayldavgtirvgygldagvtmgplaharrvdeidafvadatakgaqiatggmrlpgp
    ghyfaptvvlgptrdtrlmndepfgpivgivpfddlddalaeanrlpfglasyafttsar
    nahrisraleagmvninhfgmgpaeipfggvkdsgfgseggmeafdgylvtkfvtqmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vbfH (H:)
    hdyaplrlyidgrfhdadgrrtqpvvdpgttrvlgelphatahdidaavqaahrafvtwr
    hesplvrsdllrraaalareraetigrhitmdqgkplreaiaevvsaaeqlewhaeegrr
    tygrvvparspdvmqtvlrepigvcaafspwnfpfsqamhkiaaalasgctlvlkgpees
    psaivalaqlfhdaglppgclnivwgvpgdvskqlieapqvrkisftgsvpvgkqlaala
    aslmkrmtmelgghapvlvcadadveraaamlaaykfrnagqvcvsptrffvqraafdrf
    vcayldavgtirvgygldagvtmgplaharrvdeidafvadatakgaqiatggmrlpgpg
    hyfaptvvlgptrdtrlmndepfgpivgivpfddlddalaeanrlpfglasyafttsarn
    ahrisraleagmvninhfgmgpaeipfggvkdsgfgseggmeafdgylvtkfvtqmn