PDB entry 5v9l

View 5v9l on RCSB PDB site
Description: KRAS G12C in bound to quinazoline based switch II pocket (SWIIP) binder
Class: HYDROLASE/HYDROLASE inhibitor
Keywords: KRAS mutant inhibitor, HYDROLASE-HYDROLASE inhibitor complex
Deposited on 2017-03-23, released 2017-08-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (1-168)
      • expression tag (0)
      • engineered mutation (12)
    Domains in SCOPe 2.06: d5v9la1, d5v9la2
  • Chain 'B':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (1-168)
      • expression tag (0)
      • engineered mutation (12)
    Domains in SCOPe 2.06: d5v9lb1, d5v9lb2
  • Chain 'C':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (1-168)
      • expression tag (0)
      • engineered mutation (12)
    Domains in SCOPe 2.06: d5v9lc1, d5v9lc2
  • Heterogens: GDP, MG, 91D, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5v9lA (A:)
    gmteyklvvvgacgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildta
    gqeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcd
    lpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhke
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5v9lB (B:)
    gmteyklvvvgacgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildta
    gqeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcd
    lpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhke
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5v9lC (C:)
    gmteyklvvvgacgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildta
    gqeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcd
    lpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhke