PDB entry 5v94

View 5v94 on RCSB PDB site
Description: Pekin duck egg lysozyme isoform III (DEL-III), cubic form
Class: hydrolase
Keywords: lysozyme, glycosyl hydrolase, N-acetylmuramidase, HYDROLASE
Deposited on 2017-03-22, released 2017-11-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme isoform III
    Species: Anas platyrhynchos [TaxId:8839]
    Database cross-references and differences (RAF-indexed):
    • Uniprot U3J0P1 (0-128)
      • conflict (78)
      • conflict (99)
    Domains in SCOPe 2.06: d5v94a_
  • Chain 'B':
    Compound: lysozyme isoform III
    Species: Anas platyrhynchos [TaxId:8839]
    Database cross-references and differences (RAF-indexed):
    • Uniprot U3J0P1 (0-128)
      • conflict (78)
      • conflict (99)
    Domains in SCOPe 2.06: d5v94b_
  • Heterogens: PO4, MRD, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5v94A (A:)
    kvysrcelaaamkrlgldnyrgyslgnwvcaanyesgfntqatnrntdgstdygilqins
    rwwcddgktprsknacgircsvllrsditeavrcakrivrdgngmnawvawrnrcrgtdv
    skwirgcrl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5v94B (B:)
    kvysrcelaaamkrlgldnyrgyslgnwvcaanyesgfntqatnrntdgstdygilqins
    rwwcddgktprsknacgircsvllrsditeavrcakrivrdgngmnawvawrnrcrgtdv
    skwirgcrl