PDB entry 5v91

View 5v91 on RCSB PDB site
Description: Crystal structure of fosfomycin resistance protein from Klebsiella pneumoniae
Class: transferase
Keywords: FosA, FosAKP, fosfomycin, glutathione transferase, TRANSFERASE
Deposited on 2017-03-22, released 2017-08-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fosfomycin resistance protein
    Species: Klebsiella pneumoniae [TaxId:573]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5v91a_
  • Chain 'B':
    Compound: Fosfomycin resistance protein
    Species: Klebsiella pneumoniae [TaxId:573]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5v91b_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5v91A (A:)
    mlsglnhltlavsqlapsvafyqqllgmtlharwdsgaylscgdlwlclsldpqrrvtpp
    eesdythyafsiseadfasfaarleaagvavwklnrsegashyfldpdghklelhvgsla
    qrlaacreqpykgmvffeqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5v91A (A:)
    mlsglnhltlavsqlapsvafyqqllgmtlharwdsgaylscgdlwlclsldpqrrvtpp
    eesdythyafsiseadfasfaarleaagvavwklnrsegashyfldpdghklelhvgsla
    qrlaacreqpykgmvffe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5v91B (B:)
    mlsglnhltlavsqlapsvafyqqllgmtlharwdsgaylscgdlwlclsldpqrrvtpp
    eesdythyafsiseadfasfaarleaagvavwklnrsegashyfldpdghklelhvgsla
    qrlaacreqpykgmvffeqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5v91B (B:)
    mlsglnhltlavsqlapsvafyqqllgmtlharwdsgaylscgdlwlclsldpqrrvtpp
    eesdythyafsiseadfasfaarleaagvavwklnrsegashyfldpdghklelhvgsla
    qrlaacreqpykgmvffe