PDB entry 5v8g

View 5v8g on RCSB PDB site
Description: Pekin duck lysozyme isoform I (DEL-I)
Class: hydrolase
Keywords: lysozyme, hydrolase, N-acetylmuramidase
Deposited on 2017-03-22, released 2017-11-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme isoform I
    Species: Anas platyrhynchos [TaxId:8839]
    Database cross-references and differences (RAF-indexed):
    • Uniprot U3J0P1 (0-126)
      • conflict (36)
      • conflict (70)
    Domains in SCOPe 2.06: d5v8ga_
  • Heterogens: SCN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5v8gA (A:)
    kvysrcelaaamkrlgldnyrgyslgnwvcaanyessfntqatnrntdgstdygilqins
    rwwcddgktpgsknacgipcsvllrsditeavrcakrivsdgngmnawvawrnrcrgtdv
    skwirgc