PDB entry 5v7r

View 5v7r on RCSB PDB site
Description: Cyrstal structure of anti-Tau antibody CBTAU-7.1 Fab
Class: immune system
Keywords: antibody, Fab, tau protein, alzheimer's disease, IMMUNE SYSTEM
Deposited on 2017-03-20, released 2017-04-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-26, with a file datestamp of 2017-04-21.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: CBTAU-7.1 Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5V7R (0-End)
  • Chain 'L':
    Compound: CBTAU-7.1 Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5V7R (0-214)
    Domains in SCOPe 2.07: d5v7rl1, d5v7rl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5v7rL (L:)
    divmtqspdtlslspgeratlscrasqiissnylawyqqqpgqaprlliygassratgip
    drfsgsgsatdftltisrlepedfavyycqqygtsprtfgqgtkleikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec