PDB entry 5v6v

View 5v6v on RCSB PDB site
Description: Crystal structure of small molecule aziridine 3 covalently bound to K-Ras G12C
Class: hydrolase/hydrolase inhibitor
Keywords: K-Ras G12C, covalent inhibitor, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2017-03-17, released 2017-06-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116
      • engineered mutation (12)
      • engineered mutation (51)
      • engineered mutation (80)
      • engineered mutation (118)
    Domains in SCOPe 2.06: d5v6va_
  • Chain 'B':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116
      • engineered mutation (12)
      • engineered mutation (51)
      • engineered mutation (80)
      • engineered mutation (118)
    Domains in SCOPe 2.06: d5v6vb_
  • Heterogens: GDP, CA, 8YA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5v6vA (A:)
    gmteyklvvvgacgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetslldildta
    gqeeysamrdqymrtgegfllvfainntksfedihhyreqikrvkdsedvpmvlvgnksd
    lpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5v6vA (A:)
    teyklvvvgacgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetslldildtagq
    eeysamrdqymrtgegfllvfainntksfedihhyreqikrvkdsedvpmvlvgnksdlp
    srtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5v6vB (B:)
    gmteyklvvvgacgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetslldildta
    gqeeysamrdqymrtgegfllvfainntksfedihhyreqikrvkdsedvpmvlvgnksd
    lpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5v6vB (B:)
    teyklvvvgacgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetslldildtagq
    eeysamrdqymrtgegfllvfainntksfedihhyreqikrvkdsedvpmvlvgnksdlp
    srtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhke