PDB entry 5v6a

View 5v6a on RCSB PDB site
Description: Crystal structure of the Middle East respiratory syndrome coronavirus papain-like protease bound to ubiquitin variant ME.2
Class: hydrolase
Keywords: PLpro, ubiquitin variant, DUB, HYDROLASE
Deposited on 2017-03-16, released 2017-05-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MERS-CoV PLpro
    Species: Human betacoronavirus 2c EMC/2012 [TaxId:1235996]
    Gene: orf1ab
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5v6aa1, d5v6aa2
  • Chain 'B':
    Compound: me.2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5V6A
    Domains in SCOPe 2.07: d5v6ab_
  • Heterogens: ZN, FLC, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5v6aA (A:)
    tqqltievlvtvdgvnfrtvvlnnkntyrsqlgcvffngadisdtipdekqnghslylad
    nltadetkalkelygpvdptflhrfyslkaavhgwkmvvcdkvrslklsdnncylnavim
    tldllkdikfvipalqhafmkhkggdstdfialimaygnctfgapddasrllhtvlakae
    lccsarmvwrewcnvcgikdvvlqglkaccyvgvqtvedlrarmtyvcqcggerhrqlve
    httpwlllsgtpneklvttstapdfvafnvfqgietavghyvharlkgglilkfdsgtvs
    ktsdwkckvtdvlfpgqkyssdcn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5v6aA (A:)
    qqltievlvtvdgvnfrtvvlnnkntyrsqlgcvffngadisdtipdekqnghslyladn
    ltadetkalkelygpvdptflhrfyslkaavhgwkmvvcdkvrslklsdnncylnavimt
    ldllkdikfvipalqhafmkhkggdstdfialimaygnctfgapddasrllhtvlakael
    ccsarmvwrewcnvcgikdvvlqglkaccyvgvqtvedlrarmtyvcqcggerhrqlveh
    ttpwlllsgtpneklvttstapdfvafnvfqgietavghyvharlkgglilkfdsgtvsk
    tsdwkckvtdvlfpgqkyss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5v6aB (B:)
    mahhhhhhvtslykkagstdykddddkmrifvetlrrltitlevepsdtienvkakiqdk
    egippdqqrliffgqqledgrtlsdynivkystlhlilrlprwn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5v6aB (B:)
    mrifveltitlevepsdtienvkakiqdkegippdqqrliffgqqledgrtlsdynivky
    stlhlilrlpr