PDB entry 5v49

View 5v49 on RCSB PDB site
Description: Trypanosoma brucei methionyl-tRNA synthetase in complex with inhibitor (Chem 1917)
Class: Ligase/Ligase Inhibitor
Keywords: synthetase, ligase, methionine, inhibitor, Ligase-Ligase Inhibitor complex
Deposited on 2017-03-08, released 2017-07-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-07-26, with a file datestamp of 2017-07-21.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methionyl-tRNA synthetase, putative
    Species: Trypanosoma brucei brucei [TaxId:185431]
    Gene: Tb10.70.6470
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q38C91
      • conflict (77)
      • conflict (220-222)
      • conflict (267)
      • conflict (271)
    Domains in SCOPe 2.06: d5v49a1, d5v49a2
  • Chain 'B':
    Compound: Methionyl-tRNA synthetase, putative
    Species: Trypanosoma brucei brucei [TaxId:185431]
    Gene: Tb10.70.6470
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q38C91 (5-End)
      • expression tag (0-4)
      • conflict (77)
      • conflict (220-222)
      • conflict (267)
      • conflict (271)
    Domains in SCOPe 2.06: d5v49b1, d5v49b2, d5v49b3
  • Heterogens: MET, 8WA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5v49A (A:)
    gpgsmkvekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgq
    kvaeaakqkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqk
    gdiylgryegwysisdesfltpqnitdgvdkdgnpckvslesghvvtwvseenymfrlsa
    frerllewyhanpgcivpefrrreviravekglpdlsvsraratlhnwaipvpgnpdhcv
    yvwldaltnyltgsrlrvdesgkevslvddfnelerfpadvhvigkdilkfhaiywpafl
    lsaglplpkkivahgwwtkdrkkiskslgnvfdpvekaeefgydalkyfllresgfsddg
    dysdknmiarlngeladtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgt
    adhyylipdiqkaiiavfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttl
    llspilprksvvifdmlgvpevhrkgienfefgavppgtrlgpavegevlfskrstentk
    st
    

    Sequence, based on observed residues (ATOM records): (download)
    >5v49A (A:)
    vekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgqkvaeaa
    kqkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqkgdiylg
    ryegwysisdesfltpqnitdgvdkdgnpckvslesghvvtwvseenymfrlsafrerll
    ewyhanpgcivpefrrreviravekglpdlsvsraratlhnwaipvpgnpdhcvyvwlda
    ltnyltgsrlrvdesgkevslvddfnelerfpadvhvigkdilkfhaiywpafllsaglp
    lpkkivahgwwtknvfdpvekaeefgydalkyfllresgfsddgdysdknmiarlngela
    dtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgtadhyylipdiqkaiia
    vfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttlllspilprksvvifdm
    lgvpevhrkgienfefgavppgtrlgpavevlfskrs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5v49B (B:)
    gpgsmkvekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgq
    kvaeaakqkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqk
    gdiylgryegwysisdesfltpqnitdgvdkdgnpckvslesghvvtwvseenymfrlsa
    frerllewyhanpgcivpefrrreviravekglpdlsvsraratlhnwaipvpgnpdhcv
    yvwldaltnyltgsrlrvdesgkevslvddfnelerfpadvhvigkdilkfhaiywpafl
    lsaglplpkkivahgwwtkdrkkiskslgnvfdpvekaeefgydalkyfllresgfsddg
    dysdknmiarlngeladtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgt
    adhyylipdiqkaiiavfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttl
    llspilprksvvifdmlgvpevhrkgienfefgavppgtrlgpavegevlfskrstentk
    st
    

    Sequence, based on observed residues (ATOM records): (download)
    >5v49B (B:)
    gpgsmkvekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgq
    kvaeaakqkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqk
    gdiylgryegwysisdesfltpqnitdgvdnpckvslesghvvtwvseenymfrlsafre
    rllewyhanpgcivpefrrreviravekglpdlsvsraratlhnwaipvpgnpdhcvyvw
    ldaltnyltgsrlrvdesgkevslvddfnelerfpadvhvigkdilkfhaiywpafllsa
    glplpkkivahgwwtkdrkkiskslgnvfdpvekaeefgydalkyfllresgfsddgdys
    dknmiarlngeladtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgtadh
    yylipdiqkaiiavfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttllls
    pilprksvvifdmlgvpevhrkgienfefgavppgtrlgpavegevlfskrst