PDB entry 5v3t

View 5v3t on RCSB PDB site
Description: Crystal Structure of the Group II Truncated Hemoglobin from Bacillus Anthracis
Class: oxygen transport
Keywords: truncated hemoglobin, oxygen transport, heme protein
Deposited on 2017-03-08, released 2017-04-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: globin
    Species: Bacillus anthracis [TaxId:1392]
    Gene: yjbI, GBAA_1209, BASH2_04647, BVB96_06425
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5v3ta_
  • Chain 'B':
    Compound: globin
    Species: Bacillus anthracis [TaxId:1392]
    Gene: yjbI, GBAA_1209, BASH2_04647, BVB96_06425
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5v3tb_
  • Heterogens: HEM, CYN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5v3tA (A:)
    mskqpmtpfeaiggeqcieilvdtfysyvskhpdlspifpddltetarkqkqfltqylgg
    pnlyteehghpmlrarhlpfeitpkraeawlscmeqamddtgvhghirefvferlaltaq
    hmvntpnetgei
    

    Sequence, based on observed residues (ATOM records): (download)
    >5v3tA (A:)
    kqpmtpfeaiggeqcieilvdtfysyvskhpdlspifpddltetarkqkqfltqylggpn
    lyteehghpmlrarhlpfeitpkraeawlscmeqamddtgvhghirefvferlaltaqhm
    vntpnetgei
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5v3tB (B:)
    mskqpmtpfeaiggeqcieilvdtfysyvskhpdlspifpddltetarkqkqfltqylgg
    pnlyteehghpmlrarhlpfeitpkraeawlscmeqamddtgvhghirefvferlaltaq
    hmvntpnetgei
    

    Sequence, based on observed residues (ATOM records): (download)
    >5v3tB (B:)
    pmtpfeaiggeqcieilvdtfysyvskhpdlspifpddltetarkqkqfltqylggpnly
    teehghpmlrarhlpfeitpkraeawlscmeqamddtgvhghirefvferlaltaqhmvn
    tpn