PDB entry 5uzm

View 5uzm on RCSB PDB site
Description: Crystal structure of Glorund qRRM2 domain
Class: RNA binding protein
Keywords: quasi-RNA recognition motif, qRRM, RNA BINDING PROTEIN
Deposited on 2017-02-27, released 2017-03-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-03-22, with a file datestamp of 2017-03-17.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: AT27789p
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: glo, CG6946, Dmel_CG6946
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5uzma_
  • Chain 'B':
    Compound: AT27789p
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: glo, CG6946, Dmel_CG6946
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5uzmb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5uzmA (A:)
    gshmhgtafvvklrglpyavteqqieeffsgldiktdregilfvmdrrgratgeafvqfe
    sqddteqalgrnrekighryieifrssiaemkratga
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uzmA (A:)
    gtafvvklrglpyavteqqieeffsgldiktdregilfvmdrrgratgeafvqfesqddt
    eqalgrnrekighryieifrssiaemkrat
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5uzmB (B:)
    gshmhgtafvvklrglpyavteqqieeffsgldiktdregilfvmdrrgratgeafvqfe
    sqddteqalgrnrekighryieifrssiaemkratga
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uzmB (B:)
    tafvvklrglpyavteqqieeffsgldiktdregilfvmdrrgratgeafvqfesqddte
    qalgrnrekighryieifrssiaemkrat