PDB entry 5uzg

View 5uzg on RCSB PDB site
Description: Crystal structure of Glorund qRRM1 domain
Class: RNA binding protein
Keywords: quasi-RNA recognition motif, qRRM, RNA BINDING PROTEIN
Deposited on 2017-02-26, released 2017-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-19, with a file datestamp of 2017-04-14.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: AT27789p
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: glo, CG6946, Dmel_CG6946
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5uzga_
  • Chain 'B':
    Compound: AT27789p
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: glo, CG6946, Dmel_CG6946
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5uzgb_
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5uzgA (A:)
    gshmgespkfvrlrglpwsathkeildflenvnvtngsagihlvtsrvdgkntgeayvev
    asqedveearklnkasmghryievftatpkeakeamrkisg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uzgA (A:)
    pkfvrlrglpwsathkeildflenvnvtngsagihlvtsrvdgkntgeayvevasqedve
    earklnkasmghryievftatpkeakeamr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5uzgB (B:)
    gshmgespkfvrlrglpwsathkeildflenvnvtngsagihlvtsrvdgkntgeayvev
    asqedveearklnkasmghryievftatpkeakeamrkisg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uzgB (B:)
    pkfvrlrglpwsathkeildflenvnvtngsagihlvtsntgeayvevasqedveearkl
    nkasmghryievftatpkeakeam