PDB entry 5uy1

View 5uy1 on RCSB PDB site
Description: X-ray crystal structure of apo Halotag
Class: hydrolase
Keywords: haloalkane dehalogenase, fluorogenic, halo, tag, HYDROLASE
Deposited on 2017-02-23, released 2017-03-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-03-08, with a file datestamp of 2017-03-03.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: haloalkane dehalogenase
    Species: Rhodococcus rhodochrous [TaxId:1829]
    Gene: dhaA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A3G2 (0-286)
      • conflict (43)
      • conflict (54)
      • conflict (74)
      • conflict (83-84)
      • conflict (124)
      • conflict (151)
      • conflict (156)
      • conflict (163)
      • conflict (168)
      • conflict (171-172)
      • conflict (191)
      • conflict (220)
      • conflict (223)
      • conflict (253)
      • conflict (260)
      • conflict (268-269)
      • expression tag (287-289)
    Domains in SCOPe 2.06: d5uy1a1, d5uy1a2
  • Chain 'B':
    Compound: haloalkane dehalogenase
    Species: Rhodococcus rhodochrous [TaxId:1829]
    Gene: dhaA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A3G2 (0-286)
      • conflict (43)
      • conflict (54)
      • conflict (74)
      • conflict (83-84)
      • conflict (124)
      • conflict (151)
      • conflict (156)
      • conflict (163)
      • conflict (168)
      • conflict (171-172)
      • conflict (191)
      • conflict (220)
      • conflict (223)
      • conflict (253)
      • conflict (260)
      • conflict (268-269)
      • expression tag (287-289)
    Domains in SCOPe 2.06: d5uy1b1, d5uy1b2
  • Heterogens: EDO, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5uy1A (A:)
    igtgfpfdphyvevlgermhyvdvgprdgtpvlflhgnptssyvwrniiphvapthrcia
    pdligmgksdkpdlgyffddhvrfmdafiealgleevvlvihdwgsalgfhwakrnperv
    kgiafmefirpiptwdewpefaretfqafrttdvgrkliidqnvfiegtlpmgvvrplte
    vemdhyrepflnpvdreplwrfpnelpiagepanivalveeymdwlhqspvpkllfwgtp
    gvlippaeaarlakslpnckavdigpglnllqednpdligseiarwlstleisglehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uy1A (A:)
    igtgfpfdphyvevlgermhyvdvgprdgtpvlflhgnptssyvwrniiphvapthrcia
    pdligmgksdkpdlgyffddhvrfmdafiealgleevvlvihdwgsalgfhwakrnperv
    kgiafmefirpiptwdewpefaretfqafrttdvgrkliidqnvfiegtlpmgvvrplte
    vemdhyrepflnpvdreplwrfpnelpiagepanivalveeymdwlhqspvpkllfwgtp
    gvlippaeaarlakslpnckavdigpglnllqednpdligseiarwlstl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5uy1B (B:)
    igtgfpfdphyvevlgermhyvdvgprdgtpvlflhgnptssyvwrniiphvapthrcia
    pdligmgksdkpdlgyffddhvrfmdafiealgleevvlvihdwgsalgfhwakrnperv
    kgiafmefirpiptwdewpefaretfqafrttdvgrkliidqnvfiegtlpmgvvrplte
    vemdhyrepflnpvdreplwrfpnelpiagepanivalveeymdwlhqspvpkllfwgtp
    gvlippaeaarlakslpnckavdigpglnllqednpdligseiarwlstleisglehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uy1B (B:)
    igtgfpfdphyvevlgermhyvdvgprdgtpvlflhgnptssyvwrniiphvapthrcia
    pdligmgksdkpdlgyffddhvrfmdafiealgleevvlvihdwgsalgfhwakrnperv
    kgiafmefirpiptwdewpefaretfqafrttdvgrkliidqnvfiegtlpmgvvrplte
    vemdhyrepflnpvdreplwrfpnelpiagepanivalveeymdwlhqspvpkllfwgtp
    gvlippaeaarlakslpnckavdigpglnllqednpdligseiarwlstl