PDB entry 5uxy

View 5uxy on RCSB PDB site
Description: The crystal structure of a DegV family protein from Eubacterium eligens loaded with heptadecanoic acid to 1.80 Angstrom resolution (ALTERNATIVE REFINEMENT OF PDB 3FDJ with HEPTADECANOIC acid)
Class: transferase
Keywords: DEGV, GUT MICROBIOME, STRUCTURAL GENOMICS, PSI-2, heptadecanoic acid, TRANSFERASE
Deposited on 2017-02-23, released 2018-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-21, with a file datestamp of 2018-11-16.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DegV family protein
    Species: [Eubacterium] eligens [TaxId:39485]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5uxya_
  • Heterogens: NA, ACY, X90, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5uxyA (A:)
    snamrlvadsacdikelrgmvfkavpltistdneefcddgqldihrmldilekhkgrsyt
    acpgidawleafgdddeifvvtitagmsgtynsamaaravyleehpqakvrvidskstgp
    qmriileqlqqmieegkkfeeidgaidaymqktrlfcslkslhnlaqngrvskvvasaae
    vlgisvigtasshgtleaigkcrgdkkllvklqallddagyeggklrichvenealadki
    admikqaygttdvcvykagglcsyyaerggiilscetk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uxyA (A:)
    amrlvadsacdikelrgmvfkavpltistdneefcddgqldihrmldilekhkgrsytac
    pgidawleafgdddeifvvtitagmsgtynsamaaravyleehpqakvrvidskstgpqm
    riileqlqqmieegkkfeeidgaidaymqktrlfcslkslhnlaqngrvskvvasaaevl
    gisvigtasshgtleaigkcrgdkkllvklqallddagyeggklrichvenealadkiad
    mikqaygttdvcvykagglcsyyaerggiilscetk