PDB entry 5uwq

View 5uwq on RCSB PDB site
Description: Crystal Structure of CDC7 NES Peptide in complex with CRM1-Ran-RanBP1
Class: protein transport
Keywords: HEAT repeat, NES, nuclear export, Karyopherin, PROTEIN TRANSPORT
Deposited on 2017-02-21, released 2017-03-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-03-22, with a file datestamp of 2017-03-17.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP-binding nuclear protein ran
    Species: Homo sapiens [TaxId:9606]
    Gene: RAN, ARA24, OK/SW-cl.81
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5uwqa_
  • Chain 'B':
    Compound: Ran-specific GTPase-activating protein 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YRB1, CST20, HTN1, SFO1, YDR002W, YD8119.08
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5uwqb_
  • Chain 'C':
    Compound: Exportin-1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CRM1, KAP124, XPO1, YGR218W, G8514
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30822 (3-378)
      • expression tag (2)
    • Uniprot P30822 (379-End)
      • conflict (406)
      • conflict (502)
      • conflict (504-506)
      • conflict (987)
  • Chain 'D':
    Compound: Cell division cycle 7-related protein kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: CDC7
    Database cross-references and differences (RAF-indexed):
    • PDB 5UWQ
  • Heterogens: GNP, MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5uwqA (A:)
    metgsshhhhhhssglprgshmaaqgepqvqfklvlvgdggtgkttfvkrhltgefekky
    vatlgvevhplvfhtnrgpikfnvwdtagqekfgglrdgyyiqaqcaiimfdvtsrvtyk
    nvpnwhrdlvrvcenipivlcgnkvdikdrkvkaksivfhrkknlqyydisaksnynfek
    pflwlarkligdpnlefvampalappevvmdpalaaqyehdlevaqttalpdedddl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uwqA (A:)
    vqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdtag
    qekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdikd
    rkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappevd
    palaaqyehdlevaqttalpdedddl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5uwqB (B:)
    ggsdihfepvvhlekvdvktmeedeevlykvraklfrfdadakewkergtgdckflknkk
    tnkvrilmrrdktlkicanhiiapeytlkpnvgsdrswvyactadiaegeaeaftfairf
    gskenadkfkeefekaqeinkka
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uwqB (B:)
    ihfepvveedeevlykvraklfrfdadakewkergtgdckflknkktnkvrilmrrdktl
    kicanhiiapeytlkpnvgsdrswvyactadiaegeaeaftfairfgskenadkfkeefe
    kaqeinkk
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.