PDB entry 5uve

View 5uve on RCSB PDB site
Description: Crystal Structure of the ABC Transporter Substrate-binding protein BAB1_0226 from Brucella abortus
Class: hydrolase
Keywords: alpha-beta fold, type II periplasmic binding protein (PBP) fold, Chicago Center for Functional Annotation, Midwest Center for Structural Genomics, MCSG, PSI-Biology, HYDROLASE
Deposited on 2017-02-20, released 2017-03-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-03-08, with a file datestamp of 2017-03-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Substrate-binding region of ABC-type glycine betaine transport system
    Species: Brucella abortus (strain 2308) [TaxId:359391]
    Gene: BAB1_0226
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2YP76 (3-281)
      • expression tag (1-2)
    Domains in SCOPe 2.06: d5uvea1, d5uvea2
  • Chain 'B':
    Compound: Substrate-binding region of ABC-type glycine betaine transport system
    Species: Brucella abortus (strain 2308) [TaxId:359391]
    Gene: BAB1_0226
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2YP76 (3-281)
      • expression tag (1-2)
    Domains in SCOPe 2.06: d5uveb1, d5uveb2
  • Chain 'C':
    Compound: Substrate-binding region of ABC-type glycine betaine transport system
    Species: Brucella abortus (strain 2308) [TaxId:359391]
    Gene: BAB1_0226
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2YP76 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.06: d5uvec1, d5uvec2
  • Chain 'D':
    Compound: Substrate-binding region of ABC-type glycine betaine transport system
    Species: Brucella abortus (strain 2308) [TaxId:359391]
    Gene: BAB1_0226
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2YP76 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d5uved1, d5uved2
  • Chain 'E':
    Compound: Substrate-binding region of ABC-type glycine betaine transport system
    Species: Brucella abortus (strain 2308) [TaxId:359391]
    Gene: BAB1_0226
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2YP76 (3-281)
      • expression tag (1-2)
    Domains in SCOPe 2.06: d5uvee1, d5uvee2
  • Chain 'F':
    Compound: Substrate-binding region of ABC-type glycine betaine transport system
    Species: Brucella abortus (strain 2308) [TaxId:359391]
    Gene: BAB1_0226
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2YP76 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d5uvef1, d5uvef2
  • Chain 'G':
    Compound: Substrate-binding region of ABC-type glycine betaine transport system
    Species: Brucella abortus (strain 2308) [TaxId:359391]
    Gene: BAB1_0226
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2YP76 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d5uveg1, d5uveg2
  • Chain 'H':
    Compound: Substrate-binding region of ABC-type glycine betaine transport system
    Species: Brucella abortus (strain 2308) [TaxId:359391]
    Gene: BAB1_0226
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2YP76 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d5uveh1, d5uveh2
  • Heterogens: CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5uveA (A:)
    snavavsskidteggvlgniiltvlnangikttdriqlgatpvvrkaitageidiypeyt
    gnaafffnkaddplwkdpakayetakkldydankivwltpspanntwgiavrkdvanenk
    laslsdfgkyiagggkvvlaassefvnsaaalpafqtaygftlkpdqlitlsggdtaati
    aaaanqtnganaamvygtdggiapsglvvleddkhvqpvyqpapiireevlkkdpkieel
    lkpvfekldlttlqdlngrvqlggepakavaedflkkngflk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uveA (A:)
    navavsskidteggvlgniiltvlnangikttdriqlgatpvvrkaitageidiypeytg
    naafffnkaddplwkdpakayetakkldydankivwltpspanntwgiavrkdvanenkl
    aslsdfgkyiagggkvvlaassefvnsaaalpafqtaygftlkpdqlitlsggdtaatia
    aaanqtnganaamvygtdggiapsglvvleddkhvqpvyqpapiireevlkkdpkieell
    kpvfekldlttlqdlngrvqlggepakavaedflkkngflk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5uveB (B:)
    snavavsskidteggvlgniiltvlnangikttdriqlgatpvvrkaitageidiypeyt
    gnaafffnkaddplwkdpakayetakkldydankivwltpspanntwgiavrkdvanenk
    laslsdfgkyiagggkvvlaassefvnsaaalpafqtaygftlkpdqlitlsggdtaati
    aaaanqtnganaamvygtdggiapsglvvleddkhvqpvyqpapiireevlkkdpkieel
    lkpvfekldlttlqdlngrvqlggepakavaedflkkngflk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uveB (B:)
    navavsskidteggvlgniiltvlnangikttdriqlgatpvvrkaitageidiypeytg
    naafffnkaddplwkdpakayetakkldydankivwltpspanntwgiavrkdvanenkl
    aslsdfgkyiagggkvvlaassefvnsaaalpafqtaygftlkpdqlitlsggdtaatia
    aaanqtnganaamvygtdggiapsglvvleddkhvqpvyqpapiireevlkkdpkieell
    kpvfekldlttlqdlngrvqlggepakavaedflkkngflk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5uveC (C:)
    snavavsskidteggvlgniiltvlnangikttdriqlgatpvvrkaitageidiypeyt
    gnaafffnkaddplwkdpakayetakkldydankivwltpspanntwgiavrkdvanenk
    laslsdfgkyiagggkvvlaassefvnsaaalpafqtaygftlkpdqlitlsggdtaati
    aaaanqtnganaamvygtdggiapsglvvleddkhvqpvyqpapiireevlkkdpkieel
    lkpvfekldlttlqdlngrvqlggepakavaedflkkngflk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uveC (C:)
    navavsskidteggvlgniiltvlnangikttdriqlgatpvvrkaitageidiypeytg
    naafffnkaddplwkdpakayetakkldydankivwltpspanntwgiavrkdvanenkl
    aslsdfgkyiagggkvvlaassefvnsaaalpafqtaygftlkpdqlitlsggdtaatia
    aaanqtnganaamvygtdggiapsglvvleddkhvqpvyqpapiireevlkkdpkieell
    kpvfekldlttlqdlngrvqlggepakavaedflkkngfl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5uveD (D:)
    snavavsskidteggvlgniiltvlnangikttdriqlgatpvvrkaitageidiypeyt
    gnaafffnkaddplwkdpakayetakkldydankivwltpspanntwgiavrkdvanenk
    laslsdfgkyiagggkvvlaassefvnsaaalpafqtaygftlkpdqlitlsggdtaati
    aaaanqtnganaamvygtdggiapsglvvleddkhvqpvyqpapiireevlkkdpkieel
    lkpvfekldlttlqdlngrvqlggepakavaedflkkngflk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uveD (D:)
    snavavsskidteggvlgniiltvlnangikttdriqlgatpvvrkaitageidiypeyt
    gnaafffnkaddplwkdpakayetakkldydankivwltpspanntwgiavrkdvanenk
    laslsdfgkyiagggkvvlaassefvnsaaalpafqtaygftlkpdqlitlsggdtaati
    aaaanqtnganaamvygtdggiapsglvvleddkhvqpvyqpapiireevlkkdpkieel
    lkpvfekldlttlqdlngrvqlggepakavaedflkkngfl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5uveE (E:)
    snavavsskidteggvlgniiltvlnangikttdriqlgatpvvrkaitageidiypeyt
    gnaafffnkaddplwkdpakayetakkldydankivwltpspanntwgiavrkdvanenk
    laslsdfgkyiagggkvvlaassefvnsaaalpafqtaygftlkpdqlitlsggdtaati
    aaaanqtnganaamvygtdggiapsglvvleddkhvqpvyqpapiireevlkkdpkieel
    lkpvfekldlttlqdlngrvqlggepakavaedflkkngflk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uveE (E:)
    navavsskidteggvlgniiltvlnangikttdriqlgatpvvrkaitageidiypeytg
    naafffnkaddplwkdpakayetakkldydankivwltpspanntwgiavrkdvanenkl
    aslsdfgkyiagggkvvlaassefvnsaaalpafqtaygftlkpdqlitlsggdtaatia
    aaanqtnganaamvygtdggiapsglvvleddkhvqpvyqpapiireevlkkdpkieell
    kpvfekldlttlqdlngrvqlggepakavaedflkkngflk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5uveF (F:)
    snavavsskidteggvlgniiltvlnangikttdriqlgatpvvrkaitageidiypeyt
    gnaafffnkaddplwkdpakayetakkldydankivwltpspanntwgiavrkdvanenk
    laslsdfgkyiagggkvvlaassefvnsaaalpafqtaygftlkpdqlitlsggdtaati
    aaaanqtnganaamvygtdggiapsglvvleddkhvqpvyqpapiireevlkkdpkieel
    lkpvfekldlttlqdlngrvqlggepakavaedflkkngflk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uveF (F:)
    snavavsskidteggvlgniiltvlnangikttdriqlgatpvvrkaitageidiypeyt
    gnaafffnkaddplwkdpakayetakkldydankivwltpspanntwgiavrkdvanenk
    laslsdfgkyiagggkvvlaassefvnsaaalpafqtaygftlkpdqlitlsggdtaati
    aaaanqtnganaamvygtdggiapsglvvleddkhvqpvyqpapiireevlkkdpkieel
    lkpvfekldlttlqdlngrvqlggepakavaedflkkngfl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5uveG (G:)
    snavavsskidteggvlgniiltvlnangikttdriqlgatpvvrkaitageidiypeyt
    gnaafffnkaddplwkdpakayetakkldydankivwltpspanntwgiavrkdvanenk
    laslsdfgkyiagggkvvlaassefvnsaaalpafqtaygftlkpdqlitlsggdtaati
    aaaanqtnganaamvygtdggiapsglvvleddkhvqpvyqpapiireevlkkdpkieel
    lkpvfekldlttlqdlngrvqlggepakavaedflkkngflk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uveG (G:)
    snavavsskidteggvlgniiltvlnangikttdriqlgatpvvrkaitageidiypeyt
    gnaafffnkaddplwkdpakayetakkldydankivwltpspanntwgiavrkdvanenk
    laslsdfgkyiagggkvvlaassefvnsaaalpafqtaygftlkpdqlitlsggdtaati
    aaaanqtnganaamvygtdggiapsglvvleddkhvqpvyqpapiireevlkkdpkieel
    lkpvfekldlttlqdlngrvqlggepakavaedflkkngfl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5uveH (H:)
    snavavsskidteggvlgniiltvlnangikttdriqlgatpvvrkaitageidiypeyt
    gnaafffnkaddplwkdpakayetakkldydankivwltpspanntwgiavrkdvanenk
    laslsdfgkyiagggkvvlaassefvnsaaalpafqtaygftlkpdqlitlsggdtaati
    aaaanqtnganaamvygtdggiapsglvvleddkhvqpvyqpapiireevlkkdpkieel
    lkpvfekldlttlqdlngrvqlggepakavaedflkkngflk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uveH (H:)
    snavavsskidteggvlgniiltvlnangikttdriqlgatpvvrkaitageidiypeyt
    gnaafffnkaddplwkdpakayetakkldydankivwltpspanntwgiavrkdvanenk
    laslsdfgkyiagggkvvlaassefvnsaaalpafqtaygftlkpdqlitlsggdtaati
    aaaanqtnganaamvygtdggiapsglvvleddkhvqpvyqpapiireevlkkdpkieel
    lkpvfekldlttlqdlngrvqlggepakavaedflkkngfl