PDB entry 5uv1

View 5uv1 on RCSB PDB site
Description: Crystal Structure of (+)-Limonene Synthase Complexed with 2-Fluorogeranyl Diphosphate
Class: lyase
Keywords: Terpene synthase, enantiomer, terpene synthase fold, monoterpene, fluorinated analog, LYASE
Deposited on 2017-02-17, released 2017-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-05, with a file datestamp of 2017-03-31.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: (+)-limonene synthase
    Species: Citrus sinensis [TaxId:2711]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5uv1a1, d5uv1a2
  • Heterogens: MN, 0FV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5uv1A (A:)
    msscinpstlatsvngfkclplatnraairimaknkpvqclvstkydnltvdrrsanyqp
    siwdhdflqslnsnytdetykrraeelkgkvktaikdvtepldqlelidnlqrlglayhf
    epeirnilrnihnhnkdynwrkenlyatslefrllrqhgypvsqevfsgfkddkvgficd
    dfkgilslheasyyslegesimeeawqftskhlkemmitsnskeedvfvaeqakralelp
    lhwkapmlearwfihvyekredknhlllelaklefntlqaiyqeelkdisgwwkdtglge
    klsfarnrlvasflwsmgiafepqfaycrrvltisialitviddiydvygtldeleiftd
    avarwdinyalkhlpgymkmcflalynfvnefayyvlkqqdfdmllsikhawlgliqayl
    veakwyhskytpkleeylenglvsitgpliitisylsgtnpiikkeleflesnpdivhws
    skifrlqddlgtssdeiqrgdvpksiqcymhetgaseevarehikdmmrqmwkkvnayta
    dkdspltrttaefllnlvrmshfmylhgdghgvqnqetidvgftllfqpipledkdmaft
    aspgtkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uv1A (A:)
    siwdhdflqslnsnytdetykrraeelkgkvktaikdvtepldqlelidnlqrlglayhf
    epeirnilrnihnhnkdynwrkenlyatslefrllrqhgypvsqevfsgfkddkvgficd
    dfkgilslheasyyslegesimeeawqftskhlkemmidvfvaeqakralelplhwkapm
    learwfihvyekredknhlllelaklefntlqaiyqeelkdisgwwkdtglgeklsfarn
    rlvasflwsmgiafepqfaycrrvltisialitviddiydvygtldeleiftdavarwdi
    nyalkhlpgymkmcflalynfvnefayyvlkqqdfdmllsikhawlgliqaylveakwyh
    skytpkleeylenglvsitgpliitisylsgtnpiikkeleflesnpdivhwsskifrlq
    ddlgtssdvpksiqcymhetgaseevarehikdmmrqmwkkvnaytadkdspltrttaef
    llnlvrmshfmylhgdvgftllfqpipl