PDB entry 5uue

View 5uue on RCSB PDB site
Description: Tetragonal thermolysin cryocooled to 100 K with 50% methanol as cryoprotectant
Class: hydrolase
Keywords: zinc protease, alpha/beta, HYDROLASE
Deposited on 2017-02-16, released 2017-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-08, with a file datestamp of 2017-03-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thermolysin
    Species: Bacillus thermoproteolyticus [TaxId:1427]
    Gene: npr
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5uuea_
  • Heterogens: CA, ZN, CL, MOH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5uueA (A:)
    itgtstvgvgrgvlgdqkninttystyyylqdntrgngiftydakyrttlpgslwadadn
    qffasydapavdahyyagvtydyyknvhnrlsydgnnaairssvhysqgynnafwngsqm
    vygdgdgqtfiplsggidvvahelthavtdytagliyqnesgaineaisdifgtlvefya
    nknpdweigedvytpgisgdslrsmsdpakygdpdhyskrytgtqdnggvhinsgiinka
    aylisqggthygvsvvgigrdklgkifyraltqyltptsnfsqlraaavqsatdlygsts
    qevasvkqafdavgvk