PDB entry 5usq

View 5usq on RCSB PDB site
Description: ALK-5 kinase inhibitor complex
Class: Transferase/Transferase Inhibitor
Keywords: TGF-beta receptor type I, Serine/threonine-protein kinase receptor R4, Activin receptor-like kinase 5, Transferase-Transferase Inhibitor complex
Deposited on 2017-02-13, released 2017-04-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TGF-beta receptor type-1
    Species: Homo sapiens [TaxId:9606]
    Gene: TGFBR1, ALK5, SKR4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5usqa_
  • Heterogens: 8LY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5usqA (A:)
tiartivlqesigkgrfgevwrgkwrgeevavkifssreerswfreaeiyqtvmlrheni
lgfiaadnkdngtwtqlwlvsdyhehgslfdylnrytvtvegmiklalstasglahlhme
ivgtqgkpaiahrdlksknilvkkngtcciadlglavrhdsatdtidiapnhrvgtkrym
apevlddsinmkhfesfkradiyamglvfweiarrcsiggihedyqlpyydlvpsdpsve
emrkvvceqklrpnipnrwqscealrvmakimrecwyangaarltalrikktlsqlsqq