PDB entry 5usf

View 5usf on RCSB PDB site
Description: Leishmania donovani tyrosyl-tRNA synthetase in complex with nanobody and inhibitor
Class: ligase/ligase inhibitor
Keywords: synthetase, ligase, tyrosine, inhibitor, Ligase-Ligase Inhibitor complex, tyrosyl-adenylate analog
Deposited on 2017-02-13, released 2017-05-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-11, with a file datestamp of 2019-12-06.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosyl-tRNA synthetase, putative
    Species: Leishmania donovani (strain BPK282A1) [TaxId:981087]
    Gene: LDBPK_141460
    Database cross-references and differences (RAF-indexed):
    • Uniprot E9BC28 (4-End)
      • expression tag (2-3)
      • conflict (8)
      • conflict (110)
  • Chain 'B':
    Compound: Tyrosyl-tRNA synthetase, putative
    Species: Leishmania donovani (strain BPK282A1) [TaxId:981087]
    Gene: LDBPK_141460
    Database cross-references and differences (RAF-indexed):
    • Uniprot E9BC28 (4-End)
      • expression tag (2-3)
      • conflict (8)
      • conflict (110)
  • Chain 'C':
    Compound: immunoglobulin heavy chain variable region
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5USF (0-End)
    Domains in SCOPe 2.08: d5usfc1, d5usfc2, d5usfc3
  • Chain 'D':
    Compound: immunoglobulin heavy chain variable region
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5USF (0-End)
    Domains in SCOPe 2.08: d5usfd1, d5usfd2, d5usfd3
  • Heterogens: YSA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >5usfC (C:)
qvqlqesggglvlpggslrlscatsgftfsnswmywvrqapgkglewvsrinaggntvdy
kdsvkgrfsisrdnakntlylqmnslkpedtavyycarglnryaydsrgqgtqvtvsshh
hhhhepea

    Sequence, based on observed residues (ATOM records): (download) 
    >5usfC (C:)
qvqlqesggglvlpggslrlscatsgftfsnswmywvrqapgkglewvsrinaggntvdy
kdsvkgrfsisrdnakntlylqmnslkpedtavyycarglnryaydsrgqgtqvtvss

  • Chain 'D':
    Sequence, based on SEQRES records: (download) 
    >5usfD (D:)
qvqlqesggglvlpggslrlscatsgftfsnswmywvrqapgkglewvsrinaggntvdy
kdsvkgrfsisrdnakntlylqmnslkpedtavyycarglnryaydsrgqgtqvtvsshh
hhhhepea

    Sequence, based on observed residues (ATOM records): (download) 
    >5usfD (D:)
qvqlqesggglvlpggslrlscatsgftfsnswmywvrqapgkglewvsrinaggntvdy
kdsvkgrfsisrdnakntlylqmnslkpedtavyycarglnryaydsrgqgtqvtvsshh