PDB entry 5us4

View 5us4 on RCSB PDB site
Description: Crystal structure of human KRAS G12D mutant in complex with GDP
Class: hydrolase
Keywords: KRAS, GTPase, hydrolase
Deposited on 2017-02-13, released 2017-03-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-03-22, with a file datestamp of 2017-03-17.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (20-188)
      • engineered mutation (31)
    Domains in SCOPe 2.06: d5us4a_
  • Chain 'B':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (20-188)
      • engineered mutation (31)
    Domains in SCOPe 2.06: d5us4b_
  • Heterogens: GDP, MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5us4A (A:)
    mgsshhhhhhssglvprgshmteyklvvvgadgvgksaltiqliqnhfvdeydptiedsy
    rkqvvidgetclldildtagqeeysamrdqymrtgegflcvfainntksfedihhyreqi
    krvkdsedvpmvlvgnkcdlpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlv
    reirkhkek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5us4A (A:)
    mteyklvvvgadgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtas
    amrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdlpsrtv
    dtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5us4B (B:)
    mgsshhhhhhssglvprgshmteyklvvvgadgvgksaltiqliqnhfvdeydptiedsy
    rkqvvidgetclldildtagqeeysamrdqymrtgegflcvfainntksfedihhyreqi
    krvkdsedvpmvlvgnkcdlpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlv
    reirkhkek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5us4B (B:)
    mteyklvvvgadgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtam
    rdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdlpsrtvdt
    kqaqdlarsygipfietsaktrqgvddafytlvreirkhkek