PDB entry 5ur1

View 5ur1 on RCSB PDB site
Description: FGFR1 kinase domain complex with SN37333 in reversible binding mode
Class: transferase/transferase inhibitor
Keywords: transferase, transferase-transferase inhibitor complex
Deposited on 2017-02-09, released 2017-05-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-31, with a file datestamp of 2017-05-26.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR1, BFGFR, CEK, FGFBR, FLG, FLT2, HBGFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ur1a_
  • Chain 'B':
    Compound: fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR1, BFGFR, CEK, FGFBR, FLG, FLT2, HBGFR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362
      • engineered mutation (33)
    Domains in SCOPe 2.07: d5ur1b_
  • Heterogens: YY9, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ur1A (A:)
    gamsgvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavk
    mlksdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylq
    arrppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvted
    nvmkiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweif
    tlggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedl
    drivaltsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ur1A (A:)
    elpedprwelprdrlvlgkplgegfgqvvlaeaigldkdkpnrvtkvavkmlksdatekd
    lsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppynpsh
    npeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfglpvkwm
    apealfdriythqsdvwsfgvllweiftlggspypgvpveelfkllkeghrmdkpsnctn
    elymmmrdcwhavpsqrptfkqlvedldrivaltsnqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ur1B (B:)
    gamsgvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavk
    mlksdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylq
    arrppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvted
    nvmkiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweif
    tlggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedl
    drivaltsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ur1B (B:)
    elpedprwelprdrlvlgkplgegafgqvvlaeaigldkpnrvtkvavkmlksdatekdl
    sdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrpqlsskdl
    vscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfglpvkwmapealfdriyt
    hqsdvwsfgvllweiftlggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwh
    avpsqrptfkqlvedldrivaltsn