PDB entry 5uqh

View 5uqh on RCSB PDB site
Description: Crystal Structure of the Catalytic Domain of the Inosine Monophosphate Dehydrogenase from Campylobacter jejuni in the complex with inhibitor p182
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: IMPDH, TIM barrel, delta CBS, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, OXIDOREDUCTASE, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2017-02-08, released 2017-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Inosine-5'-monophosphate dehydrogenase,Inosine-5'-monophosphate dehydrogenase
    Species: Campylobacter jejuni subsp. jejuni CG8486 [TaxId:398000]
    Gene: guaB, Cj8486_1016
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5uqha1, d5uqha2
  • Chain 'B':
    Compound: Inosine-5'-monophosphate dehydrogenase,Inosine-5'-monophosphate dehydrogenase
    Species: Campylobacter jejuni subsp. jejuni CG8486 [TaxId:398000]
    Gene: guaB, Cj8486_1016
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5uqhb1, d5uqhb2
  • Chain 'C':
    Compound: Inosine-5'-monophosphate dehydrogenase,Inosine-5'-monophosphate dehydrogenase
    Species: Campylobacter jejuni subsp. jejuni CG8486 [TaxId:398000]
    Gene: guaB, Cj8486_1016
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5uqhc1, d5uqhc2
  • Chain 'D':
    Compound: Inosine-5'-monophosphate dehydrogenase,Inosine-5'-monophosphate dehydrogenase
    Species: Campylobacter jejuni subsp. jejuni CG8486 [TaxId:398000]
    Gene: guaB, Cj8486_1016
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5uqhd1, d5uqhd2
  • Chain 'E':
    Compound: Inosine-5'-monophosphate dehydrogenase,Inosine-5'-monophosphate dehydrogenase
    Species: Campylobacter jejuni subsp. jejuni CG8486 [TaxId:398000]
    Gene: guaB, Cj8486_1016
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5uqhe1, d5uqhe2
  • Chain 'F':
    Compound: Inosine-5'-monophosphate dehydrogenase,Inosine-5'-monophosphate dehydrogenase
    Species: Campylobacter jejuni subsp. jejuni CG8486 [TaxId:398000]
    Gene: guaB, Cj8486_1016
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5uqhf1, d5uqhf2
  • Chain 'G':
    Compound: Inosine-5'-monophosphate dehydrogenase,Inosine-5'-monophosphate dehydrogenase
    Species: Campylobacter jejuni subsp. jejuni CG8486 [TaxId:398000]
    Gene: guaB, Cj8486_1016
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5uqhg1, d5uqhg2
  • Chain 'H':
    Compound: Inosine-5'-monophosphate dehydrogenase,Inosine-5'-monophosphate dehydrogenase
    Species: Campylobacter jejuni subsp. jejuni CG8486 [TaxId:398000]
    Gene: guaB, Cj8486_1016
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5uqhh1, d5uqhh2
  • Heterogens: IMP, K, 8L1, EDO, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5uqhA (A:)
    mhhhhhhssgvdlgtenlyfqsnamkivkraltfedvllrpgysevlpkevkihtkltkn
    itlnmplisaamdtvtehraaimmarlgglgvihknmdiasqvrevkrvkksesggikdl
    kkrkeypdankdnfgrlrvgaaigvgqmdrvdalveagvdvvvldsahghskgiidtvka
    ikakypnldliagniataaaakalceagvdavkvgigpgsicttrivsgvgvpqisaide
    cveeankfgvpviadggikysgdiakalavgassvmigsllagtdespgelftyqgrqyk
    syrgmgslgamqkgssdryfqqgtaqdklvpegiegrvpyvgsirsvvhqllgglrssmg
    yvgakdiedfqkraefveittaglkeshvhdvtitheapnykvnhq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uqhA (A:)
    amkivkraltfedvllrpgysevlpkevkihtkltknitlnmplisaamdtvtehraaim
    marlgglgvihknmdiasqvrevkrvkkskeypdankdnfgrlrvgaaigvgqmdrvdal
    veagvdvvvldsahghskgiidtvkaikakypnldliagniataaaakalceagvdavkv
    gigpgsicttrivsgvgvpqisaidecveeankfgvpviadggikysgdiakalavgass
    vmigsllagtdespgelftyqgrqyksyrgmgslgamqkgssdryfqqgtaqdklvpegi
    egrvpyvgsirsvvhqllgglrssmgyvgakdiedfqkraefveittaglkeshvhdvti
    theapnyk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5uqhB (B:)
    mhhhhhhssgvdlgtenlyfqsnamkivkraltfedvllrpgysevlpkevkihtkltkn
    itlnmplisaamdtvtehraaimmarlgglgvihknmdiasqvrevkrvkksesggikdl
    kkrkeypdankdnfgrlrvgaaigvgqmdrvdalveagvdvvvldsahghskgiidtvka
    ikakypnldliagniataaaakalceagvdavkvgigpgsicttrivsgvgvpqisaide
    cveeankfgvpviadggikysgdiakalavgassvmigsllagtdespgelftyqgrqyk
    syrgmgslgamqkgssdryfqqgtaqdklvpegiegrvpyvgsirsvvhqllgglrssmg
    yvgakdiedfqkraefveittaglkeshvhdvtitheapnykvnhq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uqhB (B:)
    amkivkraltfedvllrpgysevlpkevkihtkltknitlnmplisaamdtvtehraaim
    marlgglgvihknmdiasqvrevkrvkksesggikeypdankdnfgrlrvgaaigvgqmd
    rvdalveagvdvvvldsahghskgiidtvkaikakypnldliagniataaaakalceagv
    davkvgigpgsicttrivsgvgvpqisaidecveeankfgvpviadggikysgdiakala
    vgassvmigsllagtdespgelftyqgrqyksyrgmgslgamqklvpegiegrvpyvgsi
    rsvvhqllgglrssmgyvgakdiedfqkraefveittaglkeshvhdvtitheapnyk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5uqhC (C:)
    mhhhhhhssgvdlgtenlyfqsnamkivkraltfedvllrpgysevlpkevkihtkltkn
    itlnmplisaamdtvtehraaimmarlgglgvihknmdiasqvrevkrvkksesggikdl
    kkrkeypdankdnfgrlrvgaaigvgqmdrvdalveagvdvvvldsahghskgiidtvka
    ikakypnldliagniataaaakalceagvdavkvgigpgsicttrivsgvgvpqisaide
    cveeankfgvpviadggikysgdiakalavgassvmigsllagtdespgelftyqgrqyk
    syrgmgslgamqkgssdryfqqgtaqdklvpegiegrvpyvgsirsvvhqllgglrssmg
    yvgakdiedfqkraefveittaglkeshvhdvtitheapnykvnhq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uqhC (C:)
    amkivkraltfedvllrpgysevlpkevkihtkltknitlnmplisaamdtvtehraaim
    marlgglgvihknmdiasqvrevkrvkkskeypdankdnfgrlrvgaaigvgqmdrvdal
    veagvdvvvldsahghskgiidtvkaikakypnldliagniataaaakalceagvdavkv
    gigpgsicttrivsgvgvpqisaidecveeankfgvpviadggikysgdiakalavgass
    vmigsllagtdespgelftyqgrqyksyrgmgslgamqkgsklvpegiegrvpyvgsirs
    vvhqllgglrssmgyvgakdiedfqkraefveittaglkeshvhdvtitheapnyk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5uqhD (D:)
    mhhhhhhssgvdlgtenlyfqsnamkivkraltfedvllrpgysevlpkevkihtkltkn
    itlnmplisaamdtvtehraaimmarlgglgvihknmdiasqvrevkrvkksesggikdl
    kkrkeypdankdnfgrlrvgaaigvgqmdrvdalveagvdvvvldsahghskgiidtvka
    ikakypnldliagniataaaakalceagvdavkvgigpgsicttrivsgvgvpqisaide
    cveeankfgvpviadggikysgdiakalavgassvmigsllagtdespgelftyqgrqyk
    syrgmgslgamqkgssdryfqqgtaqdklvpegiegrvpyvgsirsvvhqllgglrssmg
    yvgakdiedfqkraefveittaglkeshvhdvtitheapnykvnhq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uqhD (D:)
    amkivkraltfedvllrpgysevlpkevkihtkltknitlnmplisaamdtvtehraaim
    marlgglgvihknmdiasqvrevkrvkkserkeypdankdnfgrlrvgaaigvgqmdrvd
    alveagvdvvvldsahghskgiidtvkaikakypnldliagniataaaakalceagvdav
    kvgigpgsicttrivsgvgvpqisaidecveeankfgvpviadggikysgdiakalavga
    ssvmigsllagtdespgelftyqgrqyksyrgmgslgamqklvpegiegrvpyvgsirsv
    vhqllgglrssmgyvgakdiedfqkraefveittaglkeshvhdvtitheapnyk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5uqhE (E:)
    mhhhhhhssgvdlgtenlyfqsnamkivkraltfedvllrpgysevlpkevkihtkltkn
    itlnmplisaamdtvtehraaimmarlgglgvihknmdiasqvrevkrvkksesggikdl
    kkrkeypdankdnfgrlrvgaaigvgqmdrvdalveagvdvvvldsahghskgiidtvka
    ikakypnldliagniataaaakalceagvdavkvgigpgsicttrivsgvgvpqisaide
    cveeankfgvpviadggikysgdiakalavgassvmigsllagtdespgelftyqgrqyk
    syrgmgslgamqkgssdryfqqgtaqdklvpegiegrvpyvgsirsvvhqllgglrssmg
    yvgakdiedfqkraefveittaglkeshvhdvtitheapnykvnhq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uqhE (E:)
    amkivkraltfedvllrpgysevlpkevkihtkltknitlnmplisaamdtvtehraaim
    marlgglgvihknmdiasqvrevkrvkkserkeypdankdnfgrlrvgaaigvgqmdrvd
    alveagvdvvvldsahghskgiidtvkaikakypnldliagniataaaakalceagvdav
    kvgigpgsicttrivsgvgvpqisaidecveeankfgvpviadggikysgdiakalavga
    ssvmigsllagtdespgelftyqgrqyksyrgmgslgamqkklvpegiegrvpyvgsirs
    vvhqllgglrssmgyvgakdiedfqkraefveittaglkeshvhdvtitheapnykv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5uqhF (F:)
    mhhhhhhssgvdlgtenlyfqsnamkivkraltfedvllrpgysevlpkevkihtkltkn
    itlnmplisaamdtvtehraaimmarlgglgvihknmdiasqvrevkrvkksesggikdl
    kkrkeypdankdnfgrlrvgaaigvgqmdrvdalveagvdvvvldsahghskgiidtvka
    ikakypnldliagniataaaakalceagvdavkvgigpgsicttrivsgvgvpqisaide
    cveeankfgvpviadggikysgdiakalavgassvmigsllagtdespgelftyqgrqyk
    syrgmgslgamqkgssdryfqqgtaqdklvpegiegrvpyvgsirsvvhqllgglrssmg
    yvgakdiedfqkraefveittaglkeshvhdvtitheapnykvnhq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uqhF (F:)
    amkivkraltfedvllrpgysevlpkevkihtkltknitlnmplisaamdtvtehraaim
    marlgglgvihknmdiasqvrevkrvkksesgdlkkrkeypdankdnfgrlrvgaaigvg
    qmdrvdalveagvdvvvldsahghskgiidtvkaikakypnldliagniataaaakalce
    agvdavkvgigpgsicttrivsgvgvpqisaidecveeankfgvpviadggikysgdiak
    alavgassvmigsllagtdespgelftyqgrqyksyrgmgslgamqklvpegiegrvpyv
    gsirsvvhqllgglrssmgyvgakdiedfqkraefveittaglkeshvhdvtitheapny
    k
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5uqhG (G:)
    mhhhhhhssgvdlgtenlyfqsnamkivkraltfedvllrpgysevlpkevkihtkltkn
    itlnmplisaamdtvtehraaimmarlgglgvihknmdiasqvrevkrvkksesggikdl
    kkrkeypdankdnfgrlrvgaaigvgqmdrvdalveagvdvvvldsahghskgiidtvka
    ikakypnldliagniataaaakalceagvdavkvgigpgsicttrivsgvgvpqisaide
    cveeankfgvpviadggikysgdiakalavgassvmigsllagtdespgelftyqgrqyk
    syrgmgslgamqkgssdryfqqgtaqdklvpegiegrvpyvgsirsvvhqllgglrssmg
    yvgakdiedfqkraefveittaglkeshvhdvtitheapnykvnhq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uqhG (G:)
    amkivkraltfedvllrpgysevlpkevkihtkltknitlnmplisaamdtvtehraaim
    marlgglgvihknmdiasqvrevkrvkksekeypdankdnfgrlrvgaaigvgqmdrvda
    lveagvdvvvldsahghskgiidtvkaikakypnldliagniataaaakalceagvdavk
    vgigpgsicttrivsgvgvpqisaidecveeankfgvpviadggikysgdiakalavgas
    svmigsllagtdespgelftyqgrqyksyrgmgslgamqklvpegiegrvpyvgsirsvv
    hqllgglrssmgyvgakdiedfqkraefveittaglkeshvhdvtitheapnyk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5uqhH (H:)
    mhhhhhhssgvdlgtenlyfqsnamkivkraltfedvllrpgysevlpkevkihtkltkn
    itlnmplisaamdtvtehraaimmarlgglgvihknmdiasqvrevkrvkksesggikdl
    kkrkeypdankdnfgrlrvgaaigvgqmdrvdalveagvdvvvldsahghskgiidtvka
    ikakypnldliagniataaaakalceagvdavkvgigpgsicttrivsgvgvpqisaide
    cveeankfgvpviadggikysgdiakalavgassvmigsllagtdespgelftyqgrqyk
    syrgmgslgamqkgssdryfqqgtaqdklvpegiegrvpyvgsirsvvhqllgglrssmg
    yvgakdiedfqkraefveittaglkeshvhdvtitheapnykvnhq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uqhH (H:)
    amkivkraltfedvllrpgysevlpkevkihtkltknitlnmplisaamdtvtehraaim
    marlgglgvihknmdiasqvrevkrvkksekrkeypdankdnfgrlrvgaaigvgqmdrv
    dalveagvdvvvldsahghskgiidtvkaikakypnldliagniataaaakalceagvda
    vkvgigpgsicttrivsgvgvpqisaidecveeankfgvpviadggikysgdiakalavg
    assvmigsllagtdespgelftyqgrqyksyrgmgslgamqklvpegiegrvpyvgsirs
    vvhqllgglrssmgyvgakdiedfqkraefveittaglkeshvhdvtitheapnyk