PDB entry 5uq0

View 5uq0 on RCSB PDB site
Description: FGFR1 kinase domain complex with fragment 2,2-dimethyl-2,3-dihydrobenzofuran-7-carboxamide
Class: Transferase/Transferase inhibitor
Keywords: Kinase, Transferase-Transferase inhibitor complex
Deposited on 2017-02-05, released 2017-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-02-22, with a file datestamp of 2017-02-17.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR1, BFGFR, CEK, FGFBR, FLG, FLT2, HBGFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5uq0a_
  • Chain 'B':
    Compound: fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR1, BFGFR, CEK, FGFBR, FLG, FLT2, HBGFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5uq0b_
  • Heterogens: WP1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5uq0A (A:)
    gamsgvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavk
    mlksdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylq
    arrppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvted
    nvmkiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweif
    tlggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedl
    drivaltsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uq0A (A:)
    elpedprwelprdrlvlgkplgefgqvvlaeaigldkpnrvtkvavkmlksdatekdlsd
    lisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrpeqlsskdlv
    scayqvargmeylaskkcihrdlaarnvlvtednvmkiadfgllpvkwmapealfdriyt
    hqsdvwsfgvllweiftlggspypgvpvelfkllkeghrmdkpsnctnelymmmrdcwha
    vpsqrptfkqlvedldrivaltsnqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5uq0B (B:)
    gamsgvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavk
    mlksdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylq
    arrppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvted
    nvmkiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweif
    tlggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedl
    drivaltsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uq0B (B:)
    yelpedprwelprdrlvlgkplgegqvvlaeaiglrvtkvavkmlksdatekdlsdlise
    memmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrqlsskdlvscayqv
    argmeylaskkcihrdlaarnvlvtednvmkiadfgllpvkwmapealriythqsdvwsf
    gvllweiftlggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrpt
    fkqlvedldrivalts