PDB entry 5uov

View 5uov on RCSB PDB site
Description: HIV-1 wild Type protease with GRL-1118A , an isophthalamide-derived P2-P3 ligand with the sulfonamide isostere as the P2' group
Class: hydrolase/hydrolase inhibitor
Keywords: an isophthalamide-derived P2-P3 ligand, HIV-1 protease inhibitor GRL-1118A, darunavir, multidrug-resistant, hydrolase inhibitor complex, hydrolase-hydrolase inhibitor complex
Deposited on 2017-02-01, released 2017-05-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: XRAY
Resolution: 1.33 Å
R-factor: N/A
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot C8B467 (0-98)
    • engineered mutation (6)
    • engineered mutation (32)
    • engineered mutation (62)
    • engineered mutation (66)
    • engineered mutation (94)
  Domains in SCOPe 2.08: d5uova_
• Chain 'B':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot C8B467 (0-98)
    • engineered mutation (6)
    • engineered mutation (32)
    • engineered mutation (62)
    • engineered mutation (66)
    • engineered mutation (94)
  Domains in SCOPe 2.08: d5uovb_
• Heterogens: 8FP, NA, CL, GOL, ACT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5uovA (A:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
  qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5uovB (B:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
  qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf