PDB entry 5uoj

View 5uoj on RCSB PDB site
Description: the structure of the map kinase p38 at 2.1 angstroms resolution
Class: transferase
Keywords: transferase, map, kinase, p38
Deposited on 2017-01-31, released 2017-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Mus musculus [TaxId:10090]
    Gene: Mapk14, Crk1, Csbp1, Csbp2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5uoja_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5uojA (A:)
    gsshhhhhhssglvprgshmsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaa
    fdtktghrvavkklsrpfqsiihakrtyrelrllkhmkhenviglldvftparsleefnd
    vylvthlmgadlnnivkcqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavned
    celkildfglarhtddemtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrt
    lfpgtdhidqlklilrlvgtpgaellkkissesarnyiqslaqmpkmnfanvfiganpla
    vdllekmlvldsdkritaaqalahayfaqyhdpddepvadpydqsfesrdllidewkslt
    ydevisfvpppldqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uojA (A:)
    rptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktghrvavkklsrpfqsiih
    akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltd
    dhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglamtgyvatrwyra
    peimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkki
    ssesarnyiqslaqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaq
    yhdpddepvadpydqsfesrdllidewksltydevisfvpppl