PDB entry 5un4

View 5un4 on RCSB PDB site
Description: crystal structure of native fused 4-ot
Deposited on 2017-01-30, released 2017-04-05
Made obsolete by 6blm on 2017-04-19

The last revision was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-oxalocrotonate tautomerase
    Species: Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) [TaxId:482957]
    Gene: Bcep18194_B2498
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: 4-oxalocrotonate tautomerase
    Species: Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) [TaxId:482957]
    Gene: Bcep18194_B2498
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: 4-oxalocrotonate tautomerase
    Species: Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) [TaxId:482957]
    Gene: Bcep18194_B2498
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5un4A (A:)
    mptlevflpaghddarkaeliarltgatvdsigapiesvrvlltelpathiglggrsaad
    gappslpvivailiagrtdeqkraliaalsetsasvldaplqatrvmikdipntdfgigg
    qtaralgr
    

    Sequence, based on observed residues (ATOM records):
    >5un4A (A:)
    ptlevflpaghddarkaeliarltgatvdsigapiesvrvlltelpathiglggrsaadg
    appslpvivailiagrtdeqkraliaalsetsasvldaplqatrvmikdipntdfgiggq
    taralgr
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5un4B (B:)
    mptlevflpaghddarkaeliarltgatvdsigapiesvrvlltelpathiglggrsaad
    gappslpvivailiagrtdeqkraliaalsetsasvldaplqatrvmikdipntdfgigg
    qtaralgr
    

    Sequence, based on observed residues (ATOM records):
    >5un4B (B:)
    ptlevflpaghddarkaeliarltgatvdsigapiesvrvlltelpathiglggrsaadg
    appslpvivailiagrtdeqkraliaalsetsasvldaplqatrvmikdipntdfgiggq
    taralgr
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5un4C (C:)
    mptlevflpaghddarkaeliarltgatvdsigapiesvrvlltelpathiglggrsaad
    gappslpvivailiagrtdeqkraliaalsetsasvldaplqatrvmikdipntdfgigg
    qtaralgr
    

    Sequence, based on observed residues (ATOM records):
    >5un4C (C:)
    ptlevflpaghddarkaeliarltgatvdsigapiesvrvlltelpathiglggrsaadg
    appslpvivailiagrtdeqkraliaalsetsasvldaplqatrvmikdipntdfgiggq
    taralgr