PDB entry 5un4

View 5un4 on RCSB PDB site
Description: Crystal Structure of Native Fused 4-OT
Class: hydrolase
Keywords: 4-Oxalocrotonate-tautomerase, MIF, cis-CaaD, dehalogenase, HYDROLASE
Deposited on 2017-01-30, released 2017-04-05
Made obsolete on 2017-04-19

The last revision prior to the SCOPe 2.06 freeze date was dated 2017-04-05, with a file datestamp of 2017-03-31.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-oxalocrotonate tautomerase
    Species: Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) [TaxId:482957]
    Gene: Bcep18194_B2498
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5un4a1, d5un4a2
  • Chain 'B':
    Compound: 4-oxalocrotonate tautomerase
    Species: Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) [TaxId:482957]
    Gene: Bcep18194_B2498
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5un4b1, d5un4b2
  • Chain 'C':
    Compound: 4-oxalocrotonate tautomerase
    Species: Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) [TaxId:482957]
    Gene: Bcep18194_B2498
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5un4c1, d5un4c2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5un4A (A:)
    mptlevflpaghddarkaeliarltgatvdsigapiesvrvlltelpathiglggrsaad
    gappslpvivailiagrtdeqkraliaalsetsasvldaplqatrvmikdipntdfgigg
    qtaralgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5un4A (A:)
    ptlevflpaghddarkaeliarltgatvdsigapiesvrvlltelpathiglggrsaadg
    appslpvivailiagrtdeqkraliaalsetsasvldaplqatrvmikdipntdfgiggq
    taralgr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5un4B (B:)
    mptlevflpaghddarkaeliarltgatvdsigapiesvrvlltelpathiglggrsaad
    gappslpvivailiagrtdeqkraliaalsetsasvldaplqatrvmikdipntdfgigg
    qtaralgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5un4B (B:)
    ptlevflpaghddarkaeliarltgatvdsigapiesvrvlltelpathiglggrsaadg
    appslpvivailiagrtdeqkraliaalsetsasvldaplqatrvmikdipntdfgiggq
    taralgr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5un4C (C:)
    mptlevflpaghddarkaeliarltgatvdsigapiesvrvlltelpathiglggrsaad
    gappslpvivailiagrtdeqkraliaalsetsasvldaplqatrvmikdipntdfgigg
    qtaralgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5un4C (C:)
    ptlevflpaghddarkaeliarltgatvdsigapiesvrvlltelpathiglggrsaadg
    appslpvivailiagrtdeqkraliaalsetsasvldaplqatrvmikdipntdfgiggq
    taralgr